Sequence 1: | NP_524764.1 | Gene: | ct / 44540 | FlyBaseID: | FBgn0004198 | Length: | 2175 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001379670.1 | Gene: | ceh-21 / 180504 | WormBaseID: | WBGene00000444 | Length: | 495 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 60/202 - (29%) |
---|---|---|---|
Similarity: | 85/202 - (42%) | Gaps: | 34/202 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 1615 QDLDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKPWHMLSIKGREPFIRMQLW 1679
Fly 1680 LSDANNVER-LQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAP 1743
Fly 1744 PSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLK--QQVPH 1806
Fly 1807 GPAGQDN 1813 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ct | NP_524764.1 | CUT | 886..955 | CDD:280527 | |
CUT | 1335..1411 | CDD:280527 | |||
CUT | 1616..1690 | CDD:280527 | 30/74 (41%) | ||
Homeobox | 1749..1801 | CDD:278475 | 16/51 (31%) | ||
ceh-21 | NP_001379670.1 | CUT | 289..366 | CDD:396794 | 30/75 (40%) |
HOX | 395..447 | CDD:197696 | 16/51 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |