DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and ceh-21

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001379670.1 Gene:ceh-21 / 180504 WormBaseID:WBGene00000444 Length:495 Species:Caenorhabditis elegans


Alignment Length:202 Identity:60/202 - (29%)
Similarity:85/202 - (42%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1615 QDLDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKPWHMLSIKGREPFIRMQLW 1679
            ::|||.||..:|...|....|.|....|.:|..|||::|:||..||||.::. .||..|.||..|
 Worm   291 EELDTVDIARRILSELKERCIPQTALAEKILARSQGTLSDLLRMPKPWSVMK-NGRATFQRMSNW 354

  Fly  1680 LSDANNVER-LQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAP 1743
            |....:|.| |..|..|     ...|.||.::                   |.|......|    
 Worm   355 LGLDPDVRRALCFLPKE-----DVARITGLDE-------------------PTPAKRKKTV---- 391

  Fly  1744 PSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLK--QQVPH 1806
              |..|:.|:|.|.::|:.:|..:..|.....:.|:..|.|...|:.|:|.|.|.||:  ||:..
 Worm   392 --KVIRLTFTETQLKSLQKSFQQNHRPTREMRQKLSATLELDFSTVGNFFMNSRRRLRIDQQISR 454

  Fly  1807 GPAGQDN 1813
            ......|
 Worm   455 SSRSTGN 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 30/74 (41%)
Homeobox 1749..1801 CDD:278475 16/51 (31%)
ceh-21NP_001379670.1 CUT 289..366 CDD:396794 30/75 (40%)
HOX 395..447 CDD:197696 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.