DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and DLX6

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_005213.3 Gene:DLX6 / 1750 HGNCID:2919 Length:293 Species:Homo sapiens


Alignment Length:411 Identity:92/411 - (22%)
Similarity:122/411 - (29%) Gaps:170/411 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly  1473 QAAAMSAAMQQQQVAQAQQQAQQAQQAQQHLQQQ--------AQQHLQQQQ-HLAQQQHP-HQQH 1527
            |.::.||.|   :..|.|||.||.||.||..|||        .|.|.||.. .:|...:| |..|
Human    14 QDSSKSAFM---EFGQQQQQQQQQQQQQQQQQQQPPPPPPPPPQPHSQQSSPAMAGAHYPLHCLH 75

  Fly  1528 HQAAAAAAALHHQSMLLTSPGLPPQHAISLPPSAGGAQPGGPGGNQGS--SNP--SNSEKKPMLM 1588
            ..||||||..||..        ..||.....|.|.|   ||...|..|  :.|  |:|:..|.|.
Human    76 SAAAAAAAGSHHHH--------HHQHHHHGSPYASG---GGNSYNHRSLAAYPYMSHSQHSPYLQ 129

  Fly  1589 PVHGTNAMRSLHQHMSPTVYEMAALTQDLDTHDITTKIKE--ALLANNIGQKIFGEAVLGLSQGS 1651
            ..|.::|               ||.|:..||....|.:.|  .:..|..|:||            
Human   130 SYHNSSA---------------AAQTRGDDTDQQKTTVIENGEIRFNGKGKKI------------ 167

  Fly  1652 VSELLSKPKPWHMLSIKGREPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSD 1716
                                                                             
Human   168 ----------------------------------------------------------------- 167

  Fly  1717 TSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANE 1781
                                         :|.|.::|..|.:||...|....|..:.....||..
Human   168 -----------------------------RKPRTIYSSLQLQALNHRFQQTQYLALPERAELAAS 203

  Fly  1782 LGLATRTITNWFHNHRMRLKQQVPHGPAGQDNPIPSRESTSATPFDPVQFRILLQQR------LL 1840
            |||....:..||.|.|.:.|:.:..|    .||..|         ||:|....|..|      :.
Human   204 LGLTQTQVKIWFQNKRSKFKKLLKQG----SNPHES---------DPLQGSAALSPRSPALPPVW 255

  Fly  1841 ELHKERMGMSGAPIPYPPYFA 1861
            ::.....|:|..|..|.|.::
Human   256 DVSASAKGVSMPPNSYMPGYS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 8/75 (11%)
Homeobox 1749..1801 CDD:278475 16/51 (31%)
DLX6NP_005213.3 COG5576 119..>231 CDD:227863 36/236 (15%)
Homeobox 170..223 CDD:278475 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.