DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and Onecut1

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_032288.1 Gene:Onecut1 / 15379 MGIID:1196423 Length:465 Species:Mus musculus


Alignment Length:333 Identity:90/333 - (27%)
Similarity:135/333 - (40%) Gaps:84/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1516 HLAQQQHPHQQHHQAAAAAAAL--------HHQSML-------LTSP--------GLPPQHAISL 1557
            |.:||..||..|..||.....:        ||.:||       ||..        ||||.|    
Mouse   191 HNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHH---- 251

  Fly  1558 PPSAGGAQPGGPGGNQGSSNPSNSEKKPMLMPVHGTNAMRSLHQHMSPTVYEMAALTQDLDTHDI 1622
            |.:...||  |.|...|::.    |..|.:.....:|...|             ...::::|.::
Mouse   252 PHAHLNAQ--GHGQLLGTAR----EPNPSVTGAQVSNGSNS-------------GQMEEINTKEV 297

  Fly  1623 TTKIKEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKPWHMLSIKGREPFIRMQLWLSDANNVE 1687
            ..:|...|...:|.|.||.:.||..|||::|:||..||||..|. .|||.|.||..||.:. ..:
Mouse   298 AQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLK-SGRETFRRMWKWLQEP-EFQ 360

  Fly  1688 RLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLF 1752
            |:..|   |..|.||:      :|::..|.                      |..|  ||.|::|
Mouse   361 RMSAL---RLAACKRK------EQEHGKDR----------------------GNTP--KKPRLVF 392

  Fly  1753 SEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMR-LKQQVPHGPAGQDNPIP 1816
            ::.|:..|...|..:..|:......::.:|||...|::|:|.|.|.| |.:....|  |.::...
Mouse   393 TDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMNARRRSLDKWQDEG--GSNSGSS 455

  Fly  1817 SRESTSAT 1824
            |..|::.|
Mouse   456 SSSSSTCT 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 29/73 (40%)
Homeobox 1749..1801 CDD:278475 15/52 (29%)
Onecut1NP_032288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..84
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..141
CUT 288..362 CDD:308148 28/75 (37%)
HOX 385..440 CDD:197696 17/56 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..465 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.