DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and AgaP_AGAP010209

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_319393.4 Gene:AgaP_AGAP010209 / 1279631 VectorBaseID:AGAP010209 Length:451 Species:Anopheles gambiae


Alignment Length:297 Identity:66/297 - (22%)
Similarity:101/297 - (34%) Gaps:81/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1693 KNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGS----VGSGVGGAPPSKKQRV--L 1751
            |.||| ..|..:.|...|   ||.:::|..:....|....||    .|.|..|....|..||  :
Mosquito   190 KQERR-IQKNNKHTNKRQ---SSPSNANVVHVNQNSGSESGSHKSLRGKGPSGPSDGKPTRVRTV 250

  Fly  1752 FSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPAGQDNPIP 1816
            .:|:|...||..:..:|.|:....|.|....||:.|.|..||.|.|.:.|::.            
Mosquito   251 LNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKT------------ 303

  Fly  1817 SRESTSATPFDPVQFRILLQQRLLELHKERMGMSGAPIPYPPYFAAAAILGRSLAGIPGAAAAA- 1880
                        :|.::.:||. .|..|...||.|.|:     .|::.:...|...:.|....| 
Mosquito   304 ------------IQMKLQMQQE-KEGRKLGYGMQGIPM-----VASSPVRHDSPLNLHGLEVTAY 350

  Fly  1881 -------GAAAAAAAVGASGGDELQALNQAFK---EQMSGLDL-------------SMPTLKRER 1922
                   ...|..:.:.::|  .:.....||:   .||.|.|:             .||.:..: 
Mosquito   351 QPPWKALSDFALHSDLDSNG--SINTHTPAFQHLVNQMHGYDVGNGGGGGPGGGPGGMPPMPGQ- 412

  Fly  1923 SDDYQDDLELEGGGH--NLSDNESLEGQEPEDKTTDY 1957
                        ||.  .:..:..|.|....|.|..|
Mosquito   413 ------------GGQVPPIGSHMDLSGHHHPDSTDSY 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475 18/53 (34%)
AgaP_AGAP010209XP_319393.4 LIM1_Isl 56..110 CDD:188752
LIM2_Isl 118..173 CDD:188760
COG5576 196..>318 CDD:227863 36/149 (24%)
HOX 244..300 CDD:197696 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.