DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and AgaP_AGAP006536

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_316574.4 Gene:AgaP_AGAP006536 / 1277135 VectorBaseID:AGAP006536 Length:291 Species:Anopheles gambiae


Alignment Length:102 Identity:30/102 - (29%)
Similarity:46/102 - (45%) Gaps:18/102 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1711 QDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTI 1775
            :|.|:.:....::|.|..:              .||:.|..|:|||.:.|:..|.:|..|:...:
Mosquito   156 EDGSNSSDDGCSSDGYNKN--------------KSKRVRTTFTEEQLQVLQANFQIDSNPDGQDL 206

  Fly  1776 EFLANELGLATRTITNWFHNHRMRLKQ--QVP--HGP 1808
            |.:|...||:.|....||.|.|.|.|:  .||  |.|
Mosquito   207 ERIAQLTGLSKRVTQVWFQNSRARQKKHTHVPRDHNP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475 19/51 (37%)
AgaP_AGAP006536XP_316574.4 LIM1_AWH 36..89 CDD:188759
LIM2_AWH 97..151 CDD:188765
COG5576 <150..262 CDD:227863 30/102 (29%)
Homeobox 180..232 CDD:278475 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.