DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and AgaP_AGAP011134

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_309513.3 Gene:AgaP_AGAP011134 / 1270792 VectorBaseID:AGAP011134 Length:501 Species:Anopheles gambiae


Alignment Length:323 Identity:72/323 - (22%)
Similarity:93/323 - (28%) Gaps:113/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1610 MAALTQDLDTHDITTKIKEALLANNIGQKI------FGEAVLGLSQGSVSELLSKPKPWHMLSIK 1668
            |.:.::|.|..|   :::..:||..:....      .|:..||.|..||..:.:..|..|..|.:
Mosquito   155 MGSASEDEDEED---QMRPGVLAGLVSGGAGAAGLHHGDGPLGASDLSVQSMSTDSKTGHDDSDQ 216

  Fly  1669 GR---EPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSP 1730
            |.   :|..|                               |.:|.:|.|            ...
Mosquito   217 GSLDGDPDCR-------------------------------GDSQAENKS------------PDD 238

  Fly  1731 GPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHN 1795
            |.||...|         .|.....:|.|.|:.||:..|.|.....|.||.|.||..|.|..||.|
Mosquito   239 GAGSKRRG---------PRTTIKAKQLEVLKNAFSQTPKPTRHIREQLAKETGLPMRVIQVWFQN 294

  Fly  1796 HR---MRLKQQVPHG-------------------PAGQDNPIPSRESTSATPFDPVQFRILLQQR 1838
            .|   .||||....|                   |.|.|.|        ..|:....        
Mosquito   295 KRSKERRLKQLTSMGRGPFFGGARKMRGFPMNLSPGGLDEP--------GFPYFAAD-------- 343

  Fly  1839 LLELHKERMGMSGAPI-PY-PPYFAAAAILGRSLAGIPGA-----AAAAGAAAAAAAVGASGG 1894
                .|...|..|.|. |: .|:|......|....|.||.     ....|....|...|..||
Mosquito   344 ----GKFDFGYGGPPFHPHDAPFFGGHPGAGPMPFGGPGGPMDHPIPMVGDFGMAGPDGGPGG 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 17/82 (21%)
Homeobox 1749..1801 CDD:278475 21/54 (39%)
AgaP_AGAP011134XP_309513.3 LIM1_Lhx1_Lhx5 27..78 CDD:188753
LIM2_Lhx1_Lhx5 86..141 CDD:188761
Homeobox 247..300 CDD:278475 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.