DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and lhx6

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_002941184.1 Gene:lhx6 / 100493242 XenbaseID:XB-GENE-493341 Length:389 Species:Xenopus tropicalis


Alignment Length:400 Identity:87/400 - (21%)
Similarity:144/400 - (36%) Gaps:137/400 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1556 SLPPSAGGAQ---PGGPGGN---------QGSSNPSNSEKKPMLMPVHGTNAMRSLHQ--HMSPT 1606
            :|.|.:.|.:   .|..||.         :|:|...:.:...|:......|...||.:  |.||:
 Frog     7 NLAPHSEGNKLDSEGDSGGKVMSQDKQIPRGASRRLDGKSPHMMSHSDDENMPCSLEKEDHSSPS 71

  Fly  1607 VYEMAAL-TQDLDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKPWHM------ 1664
            .....:: :....:..:.:..|.  :.::.|.:|....:|     .|:.|:     ||:      
 Frog    72 PPSTPSVCSPPSSSSSVPSDGKN--ICSSCGLEILDRYLL-----KVNNLI-----WHVRCLECS 124

  Fly  1665 -----------LSIKGREPFIRM---------------QLWLSDANNVERLQLLKNERREA---- 1699
                       ..||.:|.|.:|               |::.||        .::..|..|    
 Frog   125 VCRTSLRQHNSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASD--------WVRRARGNAYHLA 181

  Fly  1700 ------SKRRRSTG----------------PNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGV--- 1739
                  .||:.|||                ....:|....:.|               |:|:   
 Frog   182 CFACYSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAEN---------------GNGITLE 231

  Fly  1740 GGAP--------PSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNH 1796
            |..|        |:|:.|..|:.||.:.::..||.|..|:..|::.||:..||:.|.|..||.|.
 Frog   232 GAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNC 296

  Fly  1797 RMRLKQQVP-HG--PAGQDNPIPSRESTSATP---FDPVQFRILLQQRLLELH-----KERMGMS 1850
            |.|.|:..| ||  |.|   |.|:|.::|.:.   |.|  |....:.|::.||     :.:.|..
 Frog   297 RARHKKHTPQHGVPPQG---PTPTRITSSLSDDLHFSP--FNSPERARMVTLHGYIESQVQCGQM 356

  Fly  1851 GAPIPY--PP 1858
            ...:||  ||
 Frog   357 HCRLPYAGPP 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 16/105 (15%)
Homeobox 1749..1801 CDD:278475 20/51 (39%)
lhx6XP_002941184.1 LIM1_Lhx6 96..149 CDD:188766 12/62 (19%)
LIM2_Lhx6 157..211 CDD:188768 10/61 (16%)
Homeobox 249..302 CDD:365835 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.