DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and lmx1a

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_002934210.1 Gene:lmx1a / 100492433 XenbaseID:XB-GENE-481569 Length:380 Species:Xenopus tropicalis


Alignment Length:166 Identity:45/166 - (27%)
Similarity:72/166 - (43%) Gaps:23/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1708 PNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNV 1772
            |...|:......:|...| ..|.||   ..|.....| |:.|.:.:.:|:.|.:.:|.:...|..
 Frog   160 PAASDSGKSEDEDDAGKF-DDSKGP---EDGKDQKRP-KRPRTILTTQQRRAFKASFEVSSKPCR 219

  Fly  1773 GTIEFLANELGLATRTITNWFHNHRMRLK-----QQVPHGPAGQDNP--IPSRE--STSATPFDP 1828
            ...|.||.|.||:.|.:..||.|.|.::|     ||.......|.||  |||.:  ::|::..:.
 Frog   220 KVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQQQQDQQNPSRIPSAQTHNSSSSSVEG 284

  Fly  1829 VQ--FRILLQQRLLELHKE-------RMGMSGAPIP 1855
            :.  |..|.||:||.|.:.       :.|::...:|
 Frog   285 IMNVFTTLPQQQLLSLEQNIYSADPFQQGLTPPQMP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475 16/51 (31%)
lmx1aXP_002934210.1 LIM1_Lmx1a 35..86 CDD:188756
LIM 94..148 CDD:351770
Homeobox 195..249 CDD:365835 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.