DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and wasll

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_002934285.2 Gene:wasll / 100489197 XenbaseID:XB-GENE-22061520 Length:404 Species:Xenopus tropicalis


Alignment Length:352 Identity:69/352 - (19%)
Similarity:122/352 - (34%) Gaps:87/352 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1096 RTPRETAFPSFLFSPSLFGGAAGMPGAASNAFPAMADENMRHVFEREIAKLQQHQQQQQAAQAQA 1160
            |..|.....|.:.|||.|...|.:...:........|.:::.:|:....|.:..:.|:.:.:..|
 Frog    34 RLLRRKLSKSDIGSPSNFKHLAHVGWPSGTNLDERTDADLKKLFKLAGIKEEHLKDQEMSRKIFA 98

  Fly  1161 QFPNFSSLMALQQQVLNGAQDLSLAAAAAKDIKLNGQRSSLEHSAGSSSCSKDGERDDAYP-SSL 1224
            .......:.|::::.|..||         :::    ..|..::.:.||:.....:|.:::| :|.
 Frog    99 VIEKKGGMEAVRKETLRMAQ---------REM----PDSRYKYRSRSSTNQTPPKRQNSFPVTSH 150

  Fly  1225 HGRKSEGGGTPA------------PPAPPSGPGTGAGAPPTAAPPTGGASSNSAAPSPLSNSILP 1277
            |..|......|:            |.|.||..|......|..:||. .....|..|:|..|.|.|
 Frog   151 HAAKIPVTTLPSSPFSYIASLHRMPSAQPSPLGDFPSLSPIPSPPL-LLGDFSPVPTPAQNKISP 214

  Fly  1278 -------PALSSQGEEFAATASPLQRMASITNSLITQP----PVTPHHST--------PQRPTKA 1323
                   .:|:......|....|...:::..:.||..|    |.:.|.|:        ||.|...
 Frog   215 QTSIEIKTSLTDVSARPAIPPRPPTLLSAKDSPLIPLPLPSLPASVHKSSSELSFPCQPQSPASC 279

  Fly  1324 ---------------VLPPITQQQF--------------DMFNN-----LNTEDIVRRVKEALSQ 1354
                           .:||..:::.              ::.|:     :.||..:.|.||.|..
 Frog   280 QHNDIQHASVPPPPPPIPPFLKKESPEKACLVLPSCPVEELHNSPLKCMMQTEKEIHRGKEKLRD 344

  Fly  1355 YSISQRLFGESVLGLSQGSVSDLLARP 1381
            .|    ||.|.:   .||.....::||
 Frog   345 PS----LFLEQI---RQGVQLKSISRP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527 15/52 (29%)
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475
wasllXP_002934285.2 PBD 44..89 CDD:334253 8/44 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165161464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.