DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and onecut1.2

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_002935504.1 Gene:onecut1.2 / 100488409 XenbaseID:XB-GENE-1021674 Length:417 Species:Xenopus tropicalis


Alignment Length:374 Identity:88/374 - (23%)
Similarity:129/374 - (34%) Gaps:126/374 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1512 QQQQHLAQQQHP------------------------------HQQHHQAAAAAAALHHQSMLLTS 1546
            :...|||...||                              |.||||.......:...:::...
 Frog    52 RSDHHLAASLHPGIGFGGDSPPASANSYTTLTPLQPLHDKFHHHQHHQCVPVGNVIGSFTLMRED 116

  Fly  1547 PGLPP---------------QHAISLP------------PSAGGAQPGGPGGNQGSSNPS----- 1579
            .||.|               |...|||            ||...|......||...::.|     
 Frog   117 RGLGPPSNFYSHYPKDISMGQSLSSLPSPNLTTMHSYGHPSGHLANEKMVSGNGFEAHHSMFSRI 181

  Fly  1580 ----NSEKKPMLMPVHGTNAMRSLHQH-------------MSPTVYEMAALT---QDLDTHDITT 1624
                :.|..|  .|..|..:..|:|||             ..|...:..|::   ::::|.|:..
 Frog   182 DQHFSRELSP--PPSSGVGSPNSMHQHHYVHHRPEINCRQNPPMQTQNTAISNQLEEINTKDVAQ 244

  Fly  1625 KIKEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKPWHMLSIKGREPFIRMQLWLSDAN----N 1685
            :|...|...:|.|.||.|.||..|||::|:||..||||..|. .|||.|.||..||.:..    .
 Frog   245 RIIAELKRYSIPQAIFAERVLCRSQGTLSDLLRNPKPWSKLK-SGRETFKRMWRWLQEPEFQRMA 308

  Fly  1686 VERLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRV 1750
            ..||:..|.:.:|.||..|:..|                                     |:.|:
 Frog   309 ALRLEACKRKEQEQSKAERNHVP-------------------------------------KRHRL 336

  Fly  1751 LFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMR 1799
            :|::.|:..|...|..:..|:......:|.:|||...|::|:|.|.|.|
 Frog   337 VFTDIQRRTLHAIFHENQRPSKELQITIAQQLGLELSTVSNFFMNARRR 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 31/77 (40%)
Homeobox 1749..1801 CDD:278475 16/51 (31%)
onecut1.2XP_002935504.1 CUT 235..303 CDD:367059 30/68 (44%)
HOX 331..386 CDD:197696 18/92 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.