DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and onecut3b

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_017207968.2 Gene:onecut3b / 100332965 ZFINID:ZDB-GENE-130805-1 Length:441 Species:Danio rerio


Alignment Length:636 Identity:134/636 - (21%)
Similarity:208/636 - (32%) Gaps:239/636 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1223 SLHGRKSEGGGTPAPPAPPSGPGTGAGAPPTAAPPTGGASSNSAAPSPLSNSIL--------PPA 1279
            ::||..|.|       .|.....:..|.||:|:.....:...||..|.:: |||        .||
Zfish    10 NMHGVASHG-------QPGDLMNSSHGRPPSASHRNLVSHGRSAMVSSMA-SILEGAGDYRSDPA 66

  Fly  1280 LSSQGEEFAATASPLQRMA----SITNSLITQPPVTPHHSTPQRPTKAVLPPITQQQFDMFNNLN 1340
            ||..       ..|...|.    |::|:..|..|:  .|          ||||:           
Zfish    67 LSGH-------LHPAMTMCESGMSLSNTYTTLTPL--QH----------LPPIS----------- 101

  Fly  1341 TEDIVRRVKEALSQYSISQRLFGESVLGLSQGSVSDLL--ARPKPWHMLTQKGREPFIRMKMFLE 1403
                                            :|||..  |.|.|.|                  
Zfish   102 --------------------------------TVSDKFHHAHPHPHH------------------ 116

  Fly  1404 DENAVHKLVASQYKIAPEKLMRTGSYSGSPQM---PQGLAS----------KMQAASLPMQKMMS 1455
              :|.|:.:|            ||:.|||..:   .:||||          :|.....|:..:.:
Zfish   117 --HAAHQRLA------------TGNVSGSFTLMRDDRGLASMGNLYGHYPKEMSGMGQPLSPLSN 167

  Fly  1456 ELKLQEPAQAQHLMQQMQAAAMSAAMQQQQVAQA---QQQAQQAQQAQQHLQQQAQQHLQQQQHL 1517
            .|     ....:..|.:.|....|.:...::...   :..|....::::||.:....|.......
Zfish   168 GL-----GSLHNSQQALSAYGPGAHIPNDKMLSPGGFESHAAMLSRSEEHLARSLGGHGHGMISN 227

  Fly  1518 AQQQHPHQQHHQAAAAAAALHHQSMLLTSPGLPPQHAISLPPSAGGAQPGGPGGNQGSSNPSNSE 1582
            ....|.|...|..|       :.|||...    .:|.            ||||.:.||..     
Zfish   228 LNGMHAHGHLHTPA-------NGSMLADR----ERHG------------GGPGQSGGSGQ----- 264

  Fly  1583 KKPMLMPVHGTNAMRSLHQHMSPTVYEMAALTQDLDTHDITTKIKEALLANNIGQKIFGEAVLGL 1647
                                           .::::|.::..:|...|...:|.|.||.:.:|..
Zfish   265 -------------------------------VEEINTKEVAQRITAELKRYSIPQAIFAQRILCR 298

  Fly  1648 SQGSVSELLSKPKPWHMLSIKGREPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQD 1712
            |||::|:||..||||..|. .|||.|.||..||.:. ..:|:..|   |..|.||:      :|:
Zfish   299 SQGTLSDLLRNPKPWSKLK-SGRETFRRMWKWLQEP-EFQRMSAL---RLAACKRK------EQE 352

  Fly  1713 NSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEF 1777
            ...|.:.                      .|  ||||::|::.|:..|...|..:..|:......
Zfish   353 QHKDRNM----------------------VP--KKQRLVFTDLQRRTLIAIFKENKRPSKEMQIT 393

  Fly  1778 LANELGLATRTITNWFHNHRMRL--KQQVPHGPAGQDNPIPSRESTSATPF 1826
            ::.:|||...|::|:|.|.|.|.  :.|..|..:      |.:..|||..|
Zfish   394 ISQQLGLELSTVSNFFMNARRRCVDRWQDEHASS------PGQPGTSANTF 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527 9/77 (12%)
CUT 1616..1690 CDD:280527 28/73 (38%)
Homeobox 1749..1801 CDD:278475 15/53 (28%)
onecut3bXP_017207968.2 CUT 266..338 CDD:308148 27/73 (37%)
HOX 361..416 CDD:197696 18/56 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.