DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and isl2

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001159513.1 Gene:isl2 / 100306962 XenbaseID:XB-GENE-487556 Length:333 Species:Xenopus tropicalis


Alignment Length:270 Identity:61/270 - (22%)
Similarity:93/270 - (34%) Gaps:79/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1690 QLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGV-GGAPPSKKQRVLFS 1753
            :||..|  |.|.|.:......:.|.||            |..|.|:.|.: .....:.:.|.:.:
 Frog   123 RLLPGE--EISLRDQDLLCGAEH
NLSD------------SGRPSSLRSHIHKQTEKTTRVRTVLN 173

  Fly  1754 EEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPAGQDNPIPSR 1818
            |:|...||..:|.:|.|:....|.|....||:.|.|..||.|.|.:.|::               
 Frog   174 EKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKK--------------- 223

  Fly  1819 ESTSATPFDPVQFRIL---LQQRLLELHKERMGMSGAPIPYPPYFAAAAILGRSLAGIPGAAAAA 1880
                         .||   |||:.|.......|::|.|:                  :.|:....
 Frog   224 -------------SILMKQLQQQQLNDKTSLQGLTGTPM------------------VAGSPIRH 257

  Fly  1881 GAAAAAAAVGASGGDELQALNQAFKEQMSGL----DLSMPTLKRERSDDYQDDLELEGGGHNLSD 1941
            .:|...:||      |:|.....:| .:|..    ||..|..::..|......|    |..:.||
 Frog   258 DSAVQGSAV------EVQTYQPPWK-ALSDFALQSDLDQPAFQQLVSFSESGSL----GNSSGSD 311

  Fly  1942 NESLEGQEPE 1951
            ..||..|.|:
 Frog   312 IASLSSQLPD 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 61/270 (23%)
Homeobox 1749..1801 CDD:278475 18/51 (35%)
isl2NP_001159513.1 LIM1_Isl 27..81 CDD:188752
LIM2_Isl 89..143 CDD:188760 6/21 (29%)
HOX 165..221 CDD:197696 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.