DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and hoxa3

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001120901.1 Gene:hoxa3 / 100151729 XenbaseID:XB-GENE-482267 Length:406 Species:Xenopus tropicalis


Alignment Length:335 Identity:71/335 - (21%)
Similarity:112/335 - (33%) Gaps:103/335 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1705 STGPNQQDNSSDTSSNDTNDFYTS---------------------SPGPGSVGSGVGG--APP-- 1744
            |..|.|..:::.|:|::.....||                     ..|..|.|....|  :||  
 Frog    97 SVSPPQTTSNAATASSNKATSITSPTMSKQIFPWMKESRQNTKQQKAGSSSSGESCAGDKSPPGQ 161

  Fly  1745 --SKKQRVLFSEEQKEALRLAFALDPY---PNVGTIEFLANELGLATRTITNWFHNHRMRLK--- 1801
              ||:.|..::..|...|...|..:.|   |.  .:| :||.|.|..|.|..||.|.||:.|   
 Frog   162 SSSKRARTAYTSAQLVELEKEFHFNRYLCRPR--RVE-MANLLNLTERQIKIWFQNRRMKYKKDQ 223

  Fly  1802 --QQVPHGPAGQD---NPIPS----------RESTSATPFDPVQFRILLQQRLLELHKERMGMSG 1851
              :.:.....||.   :|:|:          ....::.|::|        |.....:|......|
 Frog   224 KGKSMMTSSGGQSPCRSPVPTPSVGGYLNSMHSLVNSVPYEP--------QSPPAFNKHHPSAYG 280

  Fly  1852 APIPYP-PYFAAAAILGRSLAGIPGAAAAAGAAAAA---------AAVGASGGDELQA----LNQ 1902
            .|.||| |:.:..          |.....:|.||..         .:.||.|...:|.    :..
 Frog   281 VPAPYPSPHNSCP----------PHQKRYSGTAAVTPEYEPHPLQQSSGAYGNPHVQGSPVYVGG 335

  Fly  1903 AFKEQMSGLDLSM---PTLKRERSD-DYQDDLELEGGGH-----------NLSDNESLEGQEPED 1952
            .:.|.|:....||   ..|....|: ||.....:..|.|           :||.:.:     |:.
 Frog   336 NYVETMTNSGPSMFGLSHLSHSSSNMDYSGAGPMNSGHHHGPCDSHPTYTDLSAHHN-----PQG 395

  Fly  1953 KTTDYEKVLH 1962
            :..:..|:.|
 Frog   396 RIQEAPKLTH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475 18/54 (33%)
hoxa3NP_001120901.1 Homeobox 168..221 CDD:395001 18/55 (33%)
DUF4074 344..404 CDD:404218 12/64 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.