DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and onecut1

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001093730.1 Gene:onecut1 / 100101763 XenbaseID:XB-GENE-480152 Length:493 Species:Xenopus tropicalis


Alignment Length:354 Identity:91/354 - (25%)
Similarity:140/354 - (39%) Gaps:93/354 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1516 HLAQQQHPHQQHHQAAAAAAAL--------HHQSMLLTSPGLPPQHAISLPPSAGGAQPGGPGGN 1572
            |.|||..||..|..||.....:        ||.:| ||..|  .||.  .|||||          
 Frog   184 HGAQQGPPHYAHPSAAMPTEKMLTPNGFEAHHPAM-LTRHG--EQHL--TPPSAG---------- 233

  Fly  1573 QGSSNPSNSEKKPMLMPVHGTNAMRSLHQHMSPTVY-EMAALTQD-------------------- 1616
                          ::|::|  .....|.|::...: ::.|.|:|                    
 Frog   234 --------------MVPING--IPHHPHAHLNAQSHGQILASTRDQNPPSVTGSQINNGSNSGQM 282

  Fly  1617 --LDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKPWHMLSIKGREPFIRMQLW 1679
              ::|.::..:|...|...:|.|.||.:.||..|||::|:||..||||..|. .|||.|.||..|
 Frog   283 EEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLK-SGRETFRRMWKW 346

  Fly  1680 LSDANNVERLQLLK-------------NERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPG 1731
            |.:. ..:|:..|:             :.:..|....:...|:|...|:..|.......:     
 Frog   347 LQEP-EFQRMSALRLAALVPADPVFQHSGQLPADSLVKIGYPSQSTQSNHMSCKRKEQEH----- 405

  Fly  1732 PGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNH 1796
                |...|..|  ||.|::|::.|:..|...|..:..|:......::.:|||...|::|:|.|.
 Frog   406 ----GKDRGNTP--KKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMNA 464

  Fly  1797 RMR-LKQQVPHGPAGQDNPIPSRESTSAT 1824
            |.| |.:....|.:|..|    ..|:|:|
 Frog   465 RRRSLDKWQDEGNSGSGN----TSSSSST 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 30/95 (32%)
Homeobox 1749..1801 CDD:278475 15/52 (29%)
onecut1NP_001093730.1 CUT 281..355 CDD:308148 28/75 (37%)
HOX 413..468 CDD:197696 17/56 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.