DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and shox2

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001093694.1 Gene:shox2 / 100101703 XenbaseID:XB-GENE-480993 Length:311 Species:Xenopus tropicalis


Alignment Length:272 Identity:54/272 - (19%)
Similarity:88/272 - (32%) Gaps:79/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1670 REPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGS 1734
            |.|.:.:.|      :|||:      |...|.:.....|..::...:.......:     .|...
 Frog    70 RSPVLELDL------SVERI------RESGSPKLTEVSPEIKERKEELKQQALEE-----EGQTK 117

  Fly  1735 VGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMR 1799
            :        ..::.|..|:.||...|...|....||:....|.|:..|||:...:..||.|.|.:
 Frog   118 I--------KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAK 174

  Fly  1800 LKQQ---------------------VPHGPAG-------QDN--PIPSRESTSATPFDPVQFRIL 1834
            .::|                     .|:...|       ||:  .:||...       .||.::.
 Frog   175 CRKQENQLHKGVLIGAGSQFEACRVAPYVNVGALRMPFQQDSHCNVPSLSF-------QVQAQLQ 232

  Fly  1835 LQQRLLELHKERMGMSGAPIPY-----PPYFAAAAILGRSLAGIPGAAAAAGAAAAAAAVGASGG 1894
            |...:...|........|..||     ||:            |:|.|..||..|.||:.|.|:..
 Frog   233 LDSAVAHAHHHLHPHLTAHAPYMMFPAPPF------------GLPLATLAAETATAASVVAAAAA 285

  Fly  1895 DELQALNQAFKE 1906
            .:..:.|.:..:
 Frog   286 AKTSSKNSSIAD 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 6/19 (32%)
Homeobox 1749..1801 CDD:278475 17/51 (33%)
shox2NP_001093694.1 Homeobox 123..177 CDD:365835 17/53 (32%)
OAR 292..307 CDD:367680 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.