Sequence 1: | NP_524764.1 | Gene: | ct / 44540 | FlyBaseID: | FBgn0004198 | Length: | 2175 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093694.1 | Gene: | shox2 / 100101703 | XenbaseID: | XB-GENE-480993 | Length: | 311 | Species: | Xenopus tropicalis |
Alignment Length: | 272 | Identity: | 54/272 - (19%) |
---|---|---|---|
Similarity: | 88/272 - (32%) | Gaps: | 79/272 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 1670 REPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGS 1734
Fly 1735 VGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMR 1799
Fly 1800 LKQQ---------------------VPHGPAG-------QDN--PIPSRESTSATPFDPVQFRIL 1834
Fly 1835 LQQRLLELHKERMGMSGAPIPY-----PPYFAAAAILGRSLAGIPGAAAAAGAAAAAAAVGASGG 1894
Fly 1895 DELQALNQAFKE 1906 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ct | NP_524764.1 | CUT | 886..955 | CDD:280527 | |
CUT | 1335..1411 | CDD:280527 | |||
CUT | 1616..1690 | CDD:280527 | 6/19 (32%) | ||
Homeobox | 1749..1801 | CDD:278475 | 17/51 (33%) | ||
shox2 | NP_001093694.1 | Homeobox | 123..177 | CDD:365835 | 17/53 (32%) |
OAR | 292..307 | CDD:367680 | 1/6 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |