Sequence 1: | NP_524764.1 | Gene: | ct / 44540 | FlyBaseID: | FBgn0004198 | Length: | 2175 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001338236.1 | Gene: | DUXB / 100033411 | HGNCID: | 33345 | Length: | 345 | Species: | Homo sapiens |
Alignment Length: | 249 | Identity: | 52/249 - (20%) |
---|---|---|---|
Similarity: | 80/249 - (32%) | Gaps: | 84/249 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1672 PFIRMQLWLSDANNVERLQLLKNER-REASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSV 1735
Fly 1736 GSGVGGAPPSKKQRVLF-SEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHR-- 1797
Fly 1798 ---------MRLKQQVP----------------------------HGPAGQDNPIPSRESTSATP 1825
Fly 1826 FDPVQFRI-------LLQ--QRLLELHKERMGMSGAPIPYPPYFAAAAILGRSL 1870 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ct | NP_524764.1 | CUT | 886..955 | CDD:280527 | |
CUT | 1335..1411 | CDD:280527 | |||
CUT | 1616..1690 | CDD:280527 | 3/17 (18%) | ||
Homeobox | 1749..1801 | CDD:278475 | 18/63 (29%) | ||
DUXB | NP_001338236.1 | homeodomain | 16..72 | CDD:238039 | 6/28 (21%) |
homeodomain | 103..161 | CDD:238039 | 18/57 (32%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 282..314 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |