DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2841 and Grb10

DIOPT Version :9

Sequence 1:NP_001284821.1 Gene:CG2841 / 44529 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_038948235.1 Gene:Grb10 / 498416 RGDID:1566234 Length:691 Species:Rattus norvegicus


Alignment Length:294 Identity:62/294 - (21%)
Similarity:96/294 - (32%) Gaps:113/294 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   935 GDYIFGGAGKSQQLT------SPPSKLTIGVASP--------ILRMGIPQGK---EYHVPITVKP 982
            ||.:.....||:.|.      .|.|:..||..:|        ..|:...|||   ..::|...||
  Rat     2 GDKVGQSTSKSENLAKSGFSPQPRSQPEIGQETPRTATRGRHSQRLQQAQGKRAMNANLPARTKP 66

  Fly   983 LKDEILENQQQEKKEKPEVQELKDQEIEKESVSVKVKPKTPVKPVQKRIEKPLDQDQNSLQNHSS 1047
            .:  ||...::.:..         ..|.|.::.::|.....:....:.:        ||..|   
  Rat    67 FR--ILRGWERCRTR---------NRIAKHALGLQVLMNNDINSSVESL--------NSACN--- 109

  Fly  1048 TLPRPAKSNRFTLPAAQNNQMVSHLTMNSLPR------PVSSLERNRPVEANPAPAPFGQSTLRR 1106
                 .:|:..|:|..:|.|..|:....|..|      |...::|::||...|         |||
  Rat   110 -----MQSDTDTVPLLENGQSASNQPSASSSRGQPQASPRQKMQRSQPVHIQP---------LRR 160

  Fly  1107 TGFKERMLAKEQQEQEQALRIRVSVNESIPSSATAPKSPPE---SKPAPPSISGYVALKSTKVEV 1168
            .           ||::|.||     ..|:|:   .|...||   ..|..|               
  Rat   161 L-----------QEEDQQLR-----TSSLPA---IPNPFPELAGGAPGSP--------------- 191

  Fly  1169 KLQEPETKPVSLQVKLKPTVQPATTPSPPPPPPA 1202
                             |:|.|::.|.||..|||
  Rat   192 -----------------PSVAPSSLPPPPSQPPA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 7/28 (25%)
Grb10XP_038948235.1 RA_GRB10 266..354 CDD:340558
PH_APBB1IP 383..505 CDD:269961
BPS 523..564 CDD:401046
SH2_Grb10 584..691 CDD:198278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.