DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2841 and GRB14

DIOPT Version :9

Sequence 1:NP_001284821.1 Gene:CG2841 / 44529 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_004481.2 Gene:GRB14 / 2888 HGNCID:4565 Length:540 Species:Homo sapiens


Alignment Length:236 Identity:53/236 - (22%)
Similarity:82/236 - (34%) Gaps:87/236 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PVDASQVYSCESTIGTVGLSEIRLC-HKSESYDNFNPDVMHKFQ-RTGVARDSLSSSSDFSSSRH 187
            |.|...:.:.|....|..::.|||. :..:.|.|:    ||.:| |:|.:..|:|          
Human   316 PRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNY----MHPYQGRSGCSSQSIS---------- 366

  Fly   188 SKVTAKTPSPYSSSNSLNSMDSTGMNYTRTPVVVPPAKVLAPPP------RKK------------ 234
                   |....|.|||.:||.:|.   ::.|:..|.:.|:...      |||            
Human   367 -------PMRSISENSLVAMDFSGQ---KSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSPT 421

  Fly   235 -------------RTAP-------RPPSQVCIPEQSVPD--IPAANSKSEPAYAVI-------VK 270
                         |:.|       |..:|..|.:|.:.|  ....:|:|.|...|:       :|
Human   422 ASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIK 486

  Fly   271 RPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDL 311
            ..|:.        |:|.|  |....:.|    |||....||
Human   487 HFQII--------PVEDD--GEMFHTLD----DGHTRFTDL 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064
GRB14NP_004481.2 RA_GRB14 107..191 CDD:340556
PH_APBB1IP 230..351 CDD:269961 9/38 (24%)
BPS 370..414 CDD:401046 13/46 (28%)
SH2_Grb14 433..540 CDD:198277 23/95 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.