Sequence 1: | NP_001284821.1 | Gene: | CG2841 / 44529 | FlyBaseID: | FBgn0003159 | Length: | 1239 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004481.2 | Gene: | GRB14 / 2888 | HGNCID: | 4565 | Length: | 540 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 53/236 - (22%) |
---|---|---|---|
Similarity: | 82/236 - (34%) | Gaps: | 87/236 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 PVDASQVYSCESTIGTVGLSEIRLC-HKSESYDNFNPDVMHKFQ-RTGVARDSLSSSSDFSSSRH 187
Fly 188 SKVTAKTPSPYSSSNSLNSMDSTGMNYTRTPVVVPPAKVLAPPP------RKK------------ 234
Fly 235 -------------RTAP-------RPPSQVCIPEQSVPD--IPAANSKSEPAYAVI-------VK 270
Fly 271 RPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDL 311 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2841 | NP_001284821.1 | Ehrlichia_rpt | 372..958 | CDD:118064 | |
GRB14 | NP_004481.2 | RA_GRB14 | 107..191 | CDD:340556 | |
PH_APBB1IP | 230..351 | CDD:269961 | 9/38 (24%) | ||
BPS | 370..414 | CDD:401046 | 13/46 (28%) | ||
SH2_Grb14 | 433..540 | CDD:198277 | 23/95 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3751 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |