DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2841 and GRB7

DIOPT Version :9

Sequence 1:NP_001284821.1 Gene:CG2841 / 44529 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001229371.2 Gene:GRB7 / 2886 HGNCID:4567 Length:555 Species:Homo sapiens


Alignment Length:414 Identity:70/414 - (16%)
Similarity:118/414 - (28%) Gaps:127/414 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 GSKSPDEDSTDGHY--------ATLDLKPPIAGGPEPTPRKRLLQIKKKTAPAPPPDFQSGGDNI 349
            |...|.:..|.|..        ..|||.||                                   
Human     2 GKWRPGQGHTTGSVKPLSCSDAMELDLSPP----------------------------------- 31

  Fly   350 SLASLPEPVTPTPNIPQPAPR-ITTPLP---------IAPTANPPLAQVNGNGNGSPNGNVSKVL 404
            .|:|.||.:.|.|..|...|| ..||||         :.||....|.:........|:       
Human    32 HLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPS------- 89

  Fly   405 LNRTPTPEPRSLGSATEDDDNDTASKQADSGIGEPAPSPSVSP---EPEAEKSQQESSSEDDEAI 466
               .|.|.|                        |....||.||   .|.:.:......:.....:
Human    90 ---IPNPFP------------------------ELCSPPSQSPILGGPSSARGLLPRDASRPHVV 127

  Fly   467 KVYNFK-LCQTSKKPEPSAAT-LAELTALTAQDIEEE-------------DNHVDQPASITNGNL 516
            |||:.. .|::.:....:.|. :.|:....|..:.:|             :..::...|:.....
Human   128 KVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQA 192

  Fly   517 ATPSSETSLTSWNYLDPISPPPDFSDQQMQKRNAGSLSPGSPLDEIVDELATIINQQRLDTLIKK 581
            |.|....|...:.        .:|:..::.|.:..||.|...:...:|....|.::..:...:..
Human   193 AWPVGGDSRFVFR--------KNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNA 249

  Fly   582 QPDPQM---VEIESAKPNRLANF--------SITTAKSTTRIGRADSFQAGASGGGTEVASSGRA 635
            ...|::   :::..:.......|        ...:.|.|::..|...:.|..:.....|.:.||.
Human   250 GSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRK 314

  Fly   636 LSHRSSSH---VSLNKLEQNGIGL 656
            |....:..   |..|||.....||
Human   315 LYGMPTDFGFCVKPNKLRNGHKGL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 52/326 (16%)
GRB7NP_001229371.2 RA_GRB7 123..210 CDD:340557 13/94 (14%)
PH_APBB1IP 248..370 CDD:269961 16/91 (18%)
BPS 389..433 CDD:401046
SH2_Grb7 448..555 CDD:198276
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.