DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2841 and Grb10

DIOPT Version :9

Sequence 1:NP_001284821.1 Gene:CG2841 / 44529 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001357532.1 Gene:Grb10 / 14783 MGIID:103232 Length:621 Species:Mus musculus


Alignment Length:334 Identity:67/334 - (20%)
Similarity:110/334 - (32%) Gaps:116/334 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 CNGNGSKSPDEDST----DG-HYATLDLKPPIAGGPEPTPRKRL-----LQIKKKTAPAPPPDFQ 343
            ||    ...|.|:.    || |.:.........|.|:.:||:::     :.|.::        .|
Mouse    16 CN----MQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQPVHILRR--------LQ 68

  Fly   344 SGGDNISLASLPEPVTPTPNIPQPAPRIT-----TPLPIAPTANPP----------------LAQ 387
            .....:..||||.       ||.|.|.:|     :|..:||::.||                :..
Mouse    69 EEDQQLRTASLPA-------IPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKHCGRCEKWIPG 126

  Fly   388 VNGNGNGS---------PNGNVSKVLLNRTPTPEPRSLGSATEDDDNDTASKQADSGIGEPAPSP 443
            .|..|||.         |...:||  |.|.        |..|:     |.::.:........|:.
Mouse   127 ENTRGNGKRKIWRWQFPPGFQLSK--LTRP--------GLWTK-----TTARFSKKQPKNQCPTD 176

  Fly   444 SVSPEPEAEKSQQESSSEDDEAIKVYNFKLCQTSKKPEPSAATLAE-LTALTAQDIEE------- 500
            :|:|......||.|......: :||::          |...:.:.| ||.:||:|:.:       
Mouse   177 TVNPVARMPTSQMEKLRLRKD-VKVFS----------EDGTSKVVEILTDMTARDLCQLLVYKSH 230

  Fly   501 --EDNH---------------VDQPASITNGNLATPSSETSLTSWNYL------DPISPPPDFSD 542
              :||.               ::....:.......||....|...||.      :|::..||...
Mouse   231 CVDDNSWTLVEHHPQLGLERCLEDHEIVVQVESTMPSESKFLFRKNYAKYEFFKNPVNFFPDQMV 295

  Fly   543 QQMQKRNAG 551
            ...|:.|.|
Mouse   296 NWCQQSNGG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 46/241 (19%)
Grb10NP_001357532.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 27/120 (23%)
RA_GRB10 197..285 CDD:340558 16/98 (16%)
PH_APBB1IP 314..436 CDD:269961
BPS 453..494 CDD:312490
SH2_Grb10 514..621 CDD:198278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.