DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and IGSF9

DIOPT Version :10

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens


Alignment Length:798 Identity:191/798 - (23%)
Similarity:294/798 - (36%) Gaps:196/798 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PRIIEHPMDTTVPKNDPFTFNCQAEGNPTPTIQWFKDGRELKTDTGSHRIMLPAGGLFFLKVIHS 155
            |.::|      |.:.:|.|..|.|.|:|.|.:.|...|::|  ..|..::.:..|.|...:|   
Human   143 PAVLE------VQELEPVTLRCVARGSPLPHVTWKLRGKDL--GQGQGQVQVQNGTLRIRRV--- 196

  Fly   156 RRESDAGTYWCEAKNEFGVARSRNATLQVAFLRDEFRLEPANTRVAQGEVALMECGAPRGSPEPQ 220
             ....:|.|.|:|.:..|.|  .:||..:........:.|.|:.|...:...:.|.|........
Human   197 -ERGSSGVYTCQASSTEGSA--THATQLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLT 258

  Fly   221 ISWRKNGQTLNLVG--NKRIRIVDGGNLAIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVRP 283
            .||.::...:..:.  ..|:||:..|:|.:...:..|.|.|.||..|.:....||:|:|.|....
Human   259 YSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTVLYPA 323

  Fly   284 FLIRGPQNQTAVVGSSVVFQCRI-GGDPLPDVLWRRTASGGNMPLRRVHVLEDRSLKLDD----- 342
            .:...|......:|...|.:|.: ...||..|.|.:               :.::|:||.     
Human   324 QVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTK---------------DGKALQLDKFPGWS 373

  Fly   343 --------VTL--ED-MGEYTCEADNAVG--GITATGILTVHAPPKFVIRPKNQ-LVEIGDEVLF 393
                    :.|  || :|||:|...|::|  |.:....:.:.|||.|:.|||.: ..|:|.|:|.
Human   374 QGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVGRELLI 438

  Fly   394 ECQANGHPRPTLYWS-----------VEGNSSLLLPGYRDGRMEVTLTPEGRSVLSIARFAREDS 447
            .|.|.|.|.|.:.|:           |:.||||:|.         .||.|......         
Human   439 PCSAQGDPPPVVSWTKVGRGLQGQAQVDSNSSLILR---------PLTKEAHGHWE--------- 485

  Fly   448 GKVVTCNALNAVGSVSSRTVVSVDTQFELPPPIIEQGPVNQTLPVKSIVVLPCRTLGTPVPQVSW 512
                 |:|.|||..|::.|.|.|   ....|.::..         .|:|.||      ....|||
Human   486 -----CSASNAVARVATSTNVYV---LGTSPHVVTN---------VSVVALP------KGANVSW 527

  Fly   513 -------YLDGIPI---------DVQEHERRNLS---DAGALTISDLQRHEDEGLYTCVASNRNG 558
                   ||....:         |...|:..:|:   .|..|.:..||.| .:..::.:|.|:.|
Human   528 EPGFDGGYLQRFSVWYTPLAKRPDRMHHDWVSLAVPVGAAHLLVPGLQPH-TQYQFSVLAQNKLG 591

  Fly   559 KSSWSGYLRLDTPTNPNIKFFRAPE-LSTYPGPPGKPQ-------------MVEKGENSVTLSWT 609
            ...:|..:            ..||| |.|.|..||.|.             :..:....|.|.|.
Human   592 SGPFSEIV------------LSAPEGLPTTPAAPGLPPTEIPPPLSPPRGLVAVRTPRGVLLHWD 644

  Fly   610 RSNKVGGSSLVGYVIEMFGKNETDGWVAVGTRV--QNTTFTQTGLLPGVNYFFLIRAENSHGLSL 672
            ....| ...|.|||:|  |:..:.||..:...|  ..|.....||:..|.|.|.:.|.....:|.
Human   645 PPELV-PKRLDGYVLE--GRQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSD 706

  Fly   673 PSPMSEPITVGTRYFNSGLDLSEARASL--------LSGDVVELSNASVVDSTSMKLTWQIINGK 729
            ||..:...|       |||::..:|..|        |:|.|..:....|....|: |...::|.:
Human   707 PSNTANVST-------SGLEVYPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSI-LAGCLLNRR 763

  Fly   730 YVEGFYVYARQLPNPIVNNPAPVTSNTNPLLGSTSTSASASASASALISTKPNIAAAGKRDGETN 794
            ..      ||:....:..:|        ||:.|.:   ..||:.|||.|..|:..|..|..|...
Human   764 RA------ARRRRKRLRQDP--------PLIFSPT---GKSAAPSALGSGSPDSVAKLKLQGSPV 811

  Fly   795 QS---------GGGAPTP 803
            .|         ..|.|:|
Human   812 PSLRQSLLWGDPAGTPSP 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490 25/93 (27%)
Ig strand A 91..95 CDD:409490 1/3 (33%)
Ig strand A' 98..103 CDD:409490 0/4 (0%)
Ig strand B 107..115 CDD:409490 3/7 (43%)
Ig strand C 121..126 CDD:409490 1/4 (25%)
Ig strand C' 129..131 CDD:409490 0/1 (0%)
Ig strand D 139..142 CDD:409490 0/2 (0%)
Ig strand E 145..151 CDD:409490 2/5 (40%)
Ig strand F 162..170 CDD:409490 4/7 (57%)
Ig strand G 173..185 CDD:409490 4/11 (36%)
IgI_2_Robo 192..279 CDD:409389 22/88 (25%)
Ig strand A 192..195 CDD:409389 0/2 (0%)
Ig strand A' 197..201 CDD:409389 1/3 (33%)
Ig strand B 205..212 CDD:409389 1/6 (17%)
Ig strand C 220..225 CDD:409389 2/4 (50%)
Ig strand C' 227..230 CDD:409389 0/2 (0%)
Ig strand D 237..241 CDD:409389 2/3 (67%)
Ig strand E 244..250 CDD:409389 2/5 (40%)
Ig strand F 257..265 CDD:409389 4/7 (57%)
Ig strand G 268..279 CDD:409389 4/10 (40%)
Ig 286..370 CDD:472250 21/102 (21%)
Ig strand B 300..304 CDD:409353 1/3 (33%)
Ig strand C 313..317 CDD:409353 1/3 (33%)
Ig strand E 336..340 CDD:409353 1/3 (33%)
Ig strand F 350..355 CDD:409353 3/4 (75%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Ig_3 373..457 CDD:464046 27/95 (28%)
Ig 480..566 CDD:472250 21/104 (20%)
Ig strand B 496..500 CDD:409353 2/3 (67%)
Ig strand C 509..513 CDD:409353 3/10 (30%)
Ig strand E 533..537 CDD:409353 1/3 (33%)
Ig strand F 548..553 CDD:409353 0/4 (0%)
Ig strand G 561..564 CDD:409353 0/2 (0%)
COG3979 586..>800 CDD:443178 58/245 (24%)
FN3 588..681 CDD:238020 27/107 (25%)
fn3 864..952 CDD:394996
IGSF9NP_001128522.1 IG_like 28..110 CDD:214653
Ig strand B 37..41 CDD:409353
Ig strand C 54..58 CDD:409353
Ig strand E 91..95 CDD:409353
Ig 136..223 CDD:472250 25/93 (27%)
Ig strand B 154..158 CDD:409353 1/3 (33%)
Ig strand C 167..171 CDD:409353 0/3 (0%)
Ig strand E 189..193 CDD:409353 2/3 (67%)
Ig strand F 203..208 CDD:409353 2/4 (50%)
Ig_3 226..305 CDD:464046 17/78 (22%)
Ig <341..404 CDD:472250 18/77 (23%)
Ig strand B 341..344 CDD:409353 1/2 (50%)
Ig strand C 353..358 CDD:409353 1/4 (25%)
Ig strand E 378..382 CDD:409353 0/3 (0%)
Ig strand F 392..397 CDD:409353 3/4 (75%)
Ig 418..503 CDD:472250 32/107 (30%)
Ig strand B 436..440 CDD:409570 1/3 (33%)
Ig strand C 449..453 CDD:409570 0/3 (0%)
Ig strand E 469..473 CDD:409570 3/3 (100%)
FN3 482..>717 CDD:442628 64/289 (22%)
Ig strand F 483..488 CDD:409570 1/18 (6%)
Ig strand G 496..499 CDD:409570 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626 6/19 (32%)
FN3 625..715 CDD:238020 23/92 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919 19/74 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.