DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and DIP-delta

DIOPT Version :9

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:474 Identity:100/474 - (21%)
Similarity:159/474 - (33%) Gaps:148/474 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LAIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVRPFLI---RGPQNQTAVVGSSVVFQCRIG 307
            |.:.:|.|.|.|.|.|.|.  .....|...:|:|.|.|.::   ..|.:.......::...||..
  Fly   110 LHVNQAHQDDRGYYMCQVN--TNPMISQVGYLQVVV
PPNILDIESTPSSVAVRENQNINMTCRAD 172

  Fly   308 GDPLPDVLWRRTASGGNMPL---RRVHVLEDRSLKLDDVTLEDMGEYTCEADNAV-GGITATGIL 368
            |.|.|.::||| ..|..:.:   ::|.|.:...|.|..|:..:||.|.|.|.|.| ..::...||
  Fly   173 GFPAPKIIWRR-EDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIIL 236

  Fly   369 TVHAPPKFVIRPKNQLV--EIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVTLTP 431
            .|...|  :|...||||  ..|.:|..:|....||:..:||                        
  Fly   237 DV
EFSP--MIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYW------------------------ 275

  Fly   432 EGRSVLSIARFAREDSGKVVTCNALNAVGSVSSRTVVSVDTQFELPPPIIEQGPVNQTLPVKSIV 496
                                                                       ...|::
  Fly   276 -----------------------------------------------------------VYNSVM 281

  Fly   497 VLPCRTLGTPVPQVSWYLDGIPIDVQEHERRNLSDAGALTISDLQRHEDEGLYTCVASNRNGKSS 561
            |||.:...|...:.|:         :.|.:        |||.:|| :.|.|.|.|::.|..|:  
  Fly   282 VLPSKKYKTDYTENSY---------RAHMK--------LTIRNLQ-YGDFGNYRCISKNSLGE-- 326

  Fly   562 WSGYLRLDTPTNPNIKFFRAPELSTYPGPPGKP---QMVEKGENSVTLSWTRSNKVGGSSLVGYV 623
                      |..:|:.:..|    .|..|.|.   ..||..||::..|..........:.|||.
  Fly   327 ----------TEGSIRVYEIP----LPSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYA 377

  Fly   624 I--EMF-GKNETDGWVAVGTRVQNTTFTQTGLLPGVNYFFLIRAENSHGLSLPSPMSE-PITVGT 684
            :  ::: |...:.......:...:::..||..|||          ...|.||.|..|: .:.:|.
  Fly   378 MKNDLYPGSASSSSSGGSSSAASSSSSMQTSALPG----------GVAGNSLSSMGSKGSLAIGK 432

  Fly   685 RYFNSGLDLSEARASLLSG 703
            ..|.:....:|..||.::|
  Fly   433 STFYTERPPNEYAASSVAG 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317
I-set 91..184 CDD:254352
I-set 190..279 CDD:254352 10/32 (31%)
Ig2_Robo 193..279 CDD:143201 10/32 (31%)
I-set 283..370 CDD:254352 25/93 (27%)
Ig 300..370 CDD:299845 23/73 (32%)
Ig 388..>457 CDD:299845 7/68 (10%)
I-set 479..561 CDD:254352 18/81 (22%)
Ig 496..561 CDD:143165 17/64 (27%)
FN3 588..681 CDD:238020 22/99 (22%)
FN3 <817..856 CDD:238020
fn3 864..952 CDD:278470
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 11/34 (32%)
Ig 145..238 CDD:416386 25/93 (27%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 33/205 (16%)
Ig strand A' 250..253 CDD:409353 2/2 (100%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/87 (2%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 3/26 (12%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.