DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and DIP-delta

DIOPT Version :10

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:474 Identity:100/474 - (21%)
Similarity:159/474 - (33%) Gaps:148/474 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LAIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVRPFLI---RGPQNQTAVVGSSVVFQCRIG 307
            |.:.:|.|.|.|.|.|.|.  .....|...:|:|.|.|.::   ..|.:.......::...||..
  Fly   110 LHVNQAHQDDRGYYMCQVN--TNPMISQVGYLQVVV
PPNILDIESTPSSVAVRENQNINMTCRAD 172

  Fly   308 GDPLPDVLWRRTASGGNMPL---RRVHVLEDRSLKLDDVTLEDMGEYTCEADNAV-GGITATGIL 368
            |.|.|.::||| ..|..:.:   ::|.|.:...|.|..|:..:||.|.|.|.|.| ..::...||
  Fly   173 GFPAPKIIWRR-EDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIIL 236

  Fly   369 TVHAPPKFVIRPKNQLV--EIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVTLTP 431
            .|...|  :|...||||  ..|.:|..:|....||:..:||                        
  Fly   237 DV
EFSP--MIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYW------------------------ 275

  Fly   432 EGRSVLSIARFAREDSGKVVTCNALNAVGSVSSRTVVSVDTQFELPPPIIEQGPVNQTLPVKSIV 496
                                                                       ...|::
  Fly   276 -----------------------------------------------------------VYNSVM 281

  Fly   497 VLPCRTLGTPVPQVSWYLDGIPIDVQEHERRNLSDAGALTISDLQRHEDEGLYTCVASNRNGKSS 561
            |||.:...|...:.|:         :.|.:        |||.:|| :.|.|.|.|::.|..|:  
  Fly   282 VLPSKKYKTDYTENSY---------RAHMK--------LTIRNLQ-YGDFGNYRCISKNSLGE-- 326

  Fly   562 WSGYLRLDTPTNPNIKFFRAPELSTYPGPPGKP---QMVEKGENSVTLSWTRSNKVGGSSLVGYV 623
                      |..:|:.:..|    .|..|.|.   ..||..||::..|..........:.|||.
  Fly   327 ----------TEGSIRV
YEIP----LPSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYA 377

  Fly   624 I--EMF-GKNETDGWVAVGTRVQNTTFTQTGLLPGVNYFFLIRAENSHGLSLPSPMSE-PITVGT 684
            :  ::: |...:.......:...:::..||..|||          ...|.||.|..|: .:.:|.
  Fly   378 MKNDLYPGSASSSSSGGSSSAASSSSSMQTSALPG----------GVAGNSLSSMGSKGSLAIGK 432

  Fly   685 RYFNSGLDLSEARASLLSG 703
            ..|.:....:|..||.::|
  Fly   433 STFYTERPPNEYAASSVAG 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490
Ig strand A 91..95 CDD:409490
Ig strand A' 98..103 CDD:409490
Ig strand B 107..115 CDD:409490
Ig strand C 121..126 CDD:409490
Ig strand C' 129..131 CDD:409490
Ig strand D 139..142 CDD:409490
Ig strand E 145..151 CDD:409490
Ig strand F 162..170 CDD:409490
Ig strand G 173..185 CDD:409490
IgI_2_Robo 192..279 CDD:409389 10/32 (31%)
Ig strand A 192..195 CDD:409389
Ig strand A' 197..201 CDD:409389
Ig strand B 205..212 CDD:409389
Ig strand C 220..225 CDD:409389
Ig strand C' 227..230 CDD:409389
Ig strand D 237..241 CDD:409389
Ig strand E 244..250 CDD:409389 1/3 (33%)
Ig strand F 257..265 CDD:409389 4/7 (57%)
Ig strand G 268..279 CDD:409389 2/10 (20%)
Ig 286..370 CDD:472250 24/90 (27%)
Ig strand B 300..304 CDD:409353 0/3 (0%)
Ig strand C 313..317 CDD:409353 0/3 (0%)
Ig strand E 336..340 CDD:409353 1/3 (33%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Ig_3 373..457 CDD:464046 13/85 (15%)
Ig 480..566 CDD:472250 18/85 (21%)
Ig strand B 496..500 CDD:409353 2/3 (67%)
Ig strand C 509..513 CDD:409353 1/3 (33%)
Ig strand E 533..537 CDD:409353 1/3 (33%)
Ig strand F 548..553 CDD:409353 2/4 (50%)
Ig strand G 561..564 CDD:409353 0/2 (0%)
COG3979 586..>800 CDD:443178 28/125 (22%)
FN3 588..681 CDD:238020 22/99 (22%)
fn3 864..952 CDD:394996
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 11/34 (32%)
Ig strand B 61..65 CDD:409353
Ig strand C 74..78 CDD:409353
Ig strand E 105..112 CDD:409353 1/1 (100%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 25/93 (27%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 33/205 (16%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 2/86 (2%)
Ig strand E 295..305 CDD:409353 3/26 (12%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.