DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and DIP-gamma

DIOPT Version :10

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:421 Identity:100/421 - (23%)
Similarity:144/421 - (34%) Gaps:133/421 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 NTRVAQGEVALMECGAPRGSPEPQISW-RKNGQT-LNLVG-----NKRIRIVDGG----NLAIQE 250
            |.....|..|::.|.. |...:.::.| |.:.|| |.|.|     |.||.::...    .|.|.:
  Fly    47 NVTYPAGREAILACSV-RNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISK 110

  Fly   251 ARQSDDGRYQCVV-----KNVVGTRESATAFLKVHVRPFLIRGPQNQTAVV--GSSVVFQCRIGG 308
            .|:||.|.|.|.:     |..||.       :.|.|.|.:|....:....|  |......|:..|
  Fly   111 LRESDRGCYMCQINTSPMKKQVGC-------IDVQVPPDIINEESSADLAVQEGEDATLTCKATG 168

  Fly   309 DPLPDVLWRR-------TASGGNMPLRRVHVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATG 366
            :|.|.|.|||       ....|:..|.:|......||:|..:....||.|.|.|.|.|....:..
  Fly   169 NPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKR 233

  Fly   367 I-LTVHAPPKFVIRPKNQLV--EIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVT 428
            : |:|...|  ::|..:||:  .:|.:|..|||....|.|..||         |.|.|..     
  Fly   234 VSLSVQFAP--MVRAPSQLLGTPLGSDVQLECQVEASPSPVSYW---------LKGARTS----- 282

  Fly   429 LTPEGRSVLSIARFAREDSGKVVTCNALNAVGSVSSRTVVSVDTQFELPPPIIEQGPVNQTLPVK 493
                                        |...|||:.::.|                        
  Fly   283 ----------------------------NGFASVSTASLES------------------------ 295

  Fly   494 SIVVLPCRTLGTPVPQVSWYLDGIPIDVQEHERRNLSDAGALTISDLQRHEDEGLYTCVASNRNG 558
                      |:|.|::  .|||....:.  |||:......|.:.......|.|.|.||::|..|
  Fly   296 ----------GSPGPEM--LLDGPKYGIT--ERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLG 346

  Fly   559 KSSWSGYLRLDTPTNPNIKFFRAPELSTYPG 589
            ::  .|.|||             .|:..:||
  Fly   347 RA--EGTLRL-------------YEIKLHPG 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490
Ig strand A 91..95 CDD:409490
Ig strand A' 98..103 CDD:409490
Ig strand B 107..115 CDD:409490
Ig strand C 121..126 CDD:409490
Ig strand C' 129..131 CDD:409490
Ig strand D 139..142 CDD:409490
Ig strand E 145..151 CDD:409490
Ig strand F 162..170 CDD:409490
Ig strand G 173..185 CDD:409490
IgI_2_Robo 192..279 CDD:409389 26/97 (27%)
Ig strand A 192..195 CDD:409389
Ig strand A' 197..201 CDD:409389 1/3 (33%)
Ig strand B 205..212 CDD:409389 2/6 (33%)
Ig strand C 220..225 CDD:409389 1/5 (20%)
Ig strand C' 227..230 CDD:409389 2/3 (67%)
Ig strand D 237..241 CDD:409389 2/3 (67%)
Ig strand E 244..250 CDD:409389 2/9 (22%)
Ig strand F 257..265 CDD:409389 3/12 (25%)
Ig strand G 268..279 CDD:409389 1/10 (10%)
Ig 286..370 CDD:472250 25/93 (27%)
Ig strand B 300..304 CDD:409353 0/3 (0%)
Ig strand C 313..317 CDD:409353 1/3 (33%)
Ig strand E 336..340 CDD:409353 2/3 (67%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Ig_3 373..457 CDD:464046 16/85 (19%)
Ig 480..566 CDD:472250 18/85 (21%)
Ig strand B 496..500 CDD:409353 0/3 (0%)
Ig strand C 509..513 CDD:409353 0/3 (0%)
Ig strand E 533..537 CDD:409353 1/3 (33%)
Ig strand F 548..553 CDD:409353 2/4 (50%)
Ig strand G 561..564 CDD:409353 0/2 (0%)
COG3979 586..>800 CDD:443178 2/4 (50%)
FN3 588..681 CDD:238020 2/2 (100%)
fn3 864..952 CDD:394996
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 23/82 (28%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 26/96 (27%)
Ig strand B 160..164 CDD:409562 0/3 (0%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 40/202 (20%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 2/12 (17%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.