DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and Dscam3

DIOPT Version :10

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:1923 Identity:377/1923 - (19%)
Similarity:616/1923 - (32%) Gaps:646/1923 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GMPLRLQPQCLTNESEIQIKIKSKIKNKTASEIKRRHRNNRDFHGERLKIMPVDRSRRAVFPLLL 72
            |.||:......|....|:...||.                       |.:..|.|..|.|:..|:
  Fly   378 GKPLQANNALTTGRDNIRFLSKSS-----------------------LLVQNVGRRDRGVYQCLV 419

  Fly    73 LLAGLNGLTQVGALKGENPR-----IIEHPMDTTVPKNDPFTF-------------NCQAEGNPT 119
                            ||.|     :.|..:..|||:. .:||             .|.|.|:|.
  Fly   420 ----------------ENQRASAQAMAELKLGDTVPEL-IYTFIEQNVRPGPLISLKCSASGSPP 467

  Fly   120 PTIQWFKDGRELKTDTGSHRIMLPAGGLF---------FLKVIHSRRESDAGTYWCEAKNEFGVA 175
            |...|..|.:.:...:..||..:   |.|         .|.:.|.|.: |.|.|.|.|.|..|..
  Fly   468 PQFAWLLDSQPIMDVSLHHRFAI---GQFVDMSGDVISHLNISHVRPD-DGGLYKCVASNSMGSV 528

  Fly   176 RSRNATLQV---AFLRDEFRLEPANTRVAQGEVALMECGAP-RGSPEPQISWRKNGQTLNLVGNK 236
            : .:|.|.|   .::|   .:.|  .:...||..::.|  | .|.|..||.|.|..|.|....:.
  Fly   529 Q-HSARLNVYGPPYVR---AIGP--IKAVAGEDIIVHC--PFAGYPVEQIRWEKAHQELTTSNHY 585

  Fly   237 RI-RIVDGGNLAIQEARQS-DDGRYQCVVKNVVGTRESATAFLKVH----VRPFLIRGPQNQTAV 295
            .: .:.|||.|.|:..... |.|.|.|:|::..|........|.|:    :.||  :.|:|... 
  Fly   586 ELASVADGGQLVIKNVEPGRDQGIYTCIVRSRAGEEARRDMQLNVNSPPVIEPF--KFPKNLQE- 647

  Fly   296 VGSSVVFQCRIGGDPLPDVL-WRRTASGGNMPLRRVHVLED--RSLKLDDVTLEDMGEYTCEADN 357
             |......|.:....:|... |::..|.....|:.....|:  ..|...|::....|:|||.|.|
  Fly   648 -GGRAQITCAVSSGDMPIYFSWKKDDSSIPSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASN 711

  Fly   358 AVGGITATGILTVHAPPKFVIRPKNQLVEIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRD 422
            |...:..|..|.|...|::...|.:..:.:|:.:...|:|.|:|.||:.| .:|...    |.:|
  Fly   712 AAAKVNYTAELQVRVAPRWRYEPMDTAIMLGNTISINCEAEGYPIPTITW-FKGQGK----GSKD 771

  Fly   423 GRMEVTLTPEGRSVLSIARFAREDSGKVVTCNALNAVGSVSSRTV-VSVDTQFELPPPIIEQGPV 486
            .:   .|:....|:|  ...|.::......|.|.|.:|:...:|: ::|:     .|...||...
  Fly   772 FK---PLSMRNHSLL--LNLATDNDEGYYMCQATNEIGAGLKKTIRINVN-----EPARFEQSAR 826

  Fly   487 NQTLPVKSIVVLPCRTLGTPVPQVSWYLDGIPIDVQEHERRNLSDA-------GALTISDLQRHE 544
            |.:......|.|.|...|.....:.|..:...||:... |.::::.       ..|||....|| 
  Fly   827 NISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNF-RFSIAEMKTEKGVDSQLTIGHSDRH- 889

  Fly   545 DEGLYTCVASNRNGKSSWSGYLRLDTPTNPNIKFFRAPELSTYPGPPGKPQMVEKGENSVTLSWT 609
            |.|:|.|:|.|..|::.             .|.|....|   .|..|...::.|.|..:|.|||.
  Fly   890 DSGVYRCIAENPYGRAE-------------QIIFLAVQE---RPDTPSHLEIFEVGSRTVKLSWR 938

  Fly   610 RSNKVGGSSLVGYVIEMFGKN--ETDGWVA----------VGTRVQNTTFTQT------------ 650
            |... |.|.::.|:::.....  ::.|.:|          :...:.:|:.:::            
  Fly   939 RPFD-GNSPVLSYLVQYQALKYLQSHGSLAAAGGDWNGHVINVSLPSTSISRSYDSDLRESAIVA 1002

  Fly   651 GLLPGVNYFFLIRAENSHGLSLPSPMSEPITVGTRYFNSGLDLSEARASLLSGDVVELSNASVVD 715
            ||.|...  ||||.:..:.:. .|..:|.|.:.|:        .||.....|...|:....|   
  Fly  1003 GLTPATT--FLIRMQAINEIE-RSAYTEAIVLKTQ--------EEAPTEAPSNVQVQTGGES--- 1053

  Fly   716 STSMKLTWQI-----INGKYVEGFYVYARQLPNPIVNNPAPVTSNTNPLLGSTSTSASASASASA 775
              .:.:||||     .||:.: |:.|           |.:....|.|.:  |...|:..|...|.
  Fly  1054 --ELIVTWQIPPRESWNGELI-GYTV-----------NCSEEKQNINFI--SVVNSSLKSTIVSG 1102

  Fly   776 LISTKPNIAAAGK--RDGET----NQSGGG-----------------APTPLNTKYRMLTILNGG 817
            ..:||..:....|  |...|    |..|.|                 ||..:|     .|.|:  
  Fly  1103 WATTKATLRGLRKYSRYAVTIRAMNSFGSGPWSAAIFGTTAEGVPEAAPQNVN-----CTALS-- 1160

  Fly   818 GASSCTIT----------GLVQ-------------------------------YTL-----YEFF 836
             :.|..|:          |::|                               :||     |...
  Fly  1161 -SQSLKISWLEPPLQFHGGIIQGYKILYRPIVHQIDFPAKLEIKRTSNLETYLHTLHKASNYSIR 1224

  Fly   837 IVPFYKSVEGKPSNSRIARTLEDVPSEAPYGMEALLLNSSAVFLKWKAPELKDRHGVLLNYHVIV 901
            ::.:..:.:|..|:....:|.:||| :||..::|..|.:.::.:.|..|  |:|:|::.:|.|..
  Fly  1225 VLAYTATGDGLASHPLFCQTDDDVP-DAPAAIKAAALTADSILISWLTP--KNRNGIISHYTVYS 1286

  Fly   902 RGIDTAHNFSRILTNVTIDAASPTLVLANLTEGVMYTVGVAAGNNAGVGPYCVPATLRLDPITKR 966
            |...........:..|..:....|....:|.|..||...|:|..:.|.|          :| |..
  Fly  1287 REAGRKGQAKTHMVRVDENGYPVTFESRSLAENQMYEFWVSASTSVGEG----------EP-TSV 1340

  Fly   967 LDPFINQRYPINQDHVNDVLTQPWFIILLGAILAVLM----------------LSFGAMVFVKRK 1015
            :....|.|.|........|:.:   .:..|.:|..|.                ::|.....|..:
  Fly  1341 IAQATNTRAPARIASFGQVVRK---AVGTGLVLECLAVGNPTPRARWLTRDRPVTFSPFYEVTNE 1402

  Fly  1016 HMMMKQSALNTMRGNHT--------SD-------VLKMPSL-----------SAR-------NG- 1046
            ..:.......::.||:|        ||       .:|.||.           |.|       :| 
  Fly  1403 GNLKIHRVEGSLSGNYTCTANNLFGSDEIQYQVIAMKPPSAPQIIVQYASADSIRVSWDAPDDGG 1467

  Fly  1047 ---NGYWLDSSTGGMVWR-----PSPGGDSLEMQKDHIADYAPVCG-------APGSPAGGGTSS 1096
               .||.:...|.|..|.     |.....::...|         ||       :..:..|.|.:|
  Fly  1468 APLQGYTISYHTAGESWSITELLPENNAFTISGLK---------CGNQYIIKMSAHNMVGSGVAS 1523

  Fly  1097 --------GGSGGA------------------GSGASGGDDIHGGH------------------- 1116
                    |.:..|                  .|..:||..||  |                   
  Fly  1524 EEINVWTKGKASQAPNANELIATNATCVNLKLSSWQNGGCSIH--HFSIEHRPLGDIRWTVVTSD 1586

  Fly  1117 --GSERNQQRYVGEYSN-IPTDYAEV-----SSFGKAPSEYGRH-------GNASPAP------- 1159
              .:|.|::..:  :.: :|..:.::     :..||....|  |       |...|.|       
  Fly  1587 ISNAEENRENLI--FCDFLPAKWYQLRISATNDAGKTTEHY--HFSTTNIDGITIPPPSVFPSEN 1647

  Fly  1160 -----------------YATSSI------------LSPHQQQQQQQP---RYQQRPVPGYGLQRP 1192
                             :||..:            |:...::....|   .|:.|.:||      
  Fly  1648 DLMNNLINSTNPTSGDWFATLIVVVIITVSIITIALTIKHRRTLCGPIAEGYESRTLPG------ 1706

  Fly  1193 MHPHYQQQQHQQQQAQQTHQQHQALQQHQQLPPSNIYQQMSTTSEIY-----------------P 1240
               .| ::.|:.::.||.:...         |...:  .....||:|                 |
  Fly  1707 ---DY-KEDHENRRNQQVYSAS---------PVKTV--DKGNESEMYEISPYATFSVNGGRTGAP 1756

  Fly  1241 TNTGPSRSV-------YSEQY--------------YYPK---------------DKQRHIHI-TE 1268
            ..| |:|:|       |:.|:              .||.               .|||:.:. .|
  Fly  1757 AKT-PTRAVAAQTPLDYTMQFKTFGHPEGENLNATAYPLLPSSGFGHVKSKSSWHKQRYYNTEDE 1820

  Fly  1269 NKLSNCHTYEAAPGAKQS----------------------------SPISSQFASVRRQQLPPNC 1305
            :.||...|..|...|..|                            || |::|:::...::|  |
  Fly  1821 STLSKSMTIVAGSQAGHSKKSNGGRSAKSSAACSGVVAGSESDTSISP-STEFSNMPTYRVP--C 1882

  Fly  1306 SIGRESARFKVL-----------NTDQG--------KNQQNLLDLDGSSMCYNGLADSGCGGSPS 1351
            ...|.|....|:           |.|||        ...:::|.: |.:|...|....|.||...
  Fly  1883 KSSRSSDGRAVVDMFRPDSSTESNNDQGSPAPERRHNTPRHVLGM-GMAMGLGGGGGGGVGGGNG 1946

  Fly  1352 PMAMLMSHEDEHALYHTADGDLDDMERLYVKVDEQQPPQQQQQLIPLVPQHPAEGHLQSWRNQST 1416
            |.                               |::...|:.:......|.|:...|:  |.:..
  Fly  1947 PA-------------------------------EKRSAGQRSRKHGSAAQQPSNQTLE--RRKCP 1978

  Fly  1417 RSSRKNGQECIKEPSELIYAPGSVASERSLLSNSGSGTS-----SQPAG-HNVXPLLPG--SSLG 1473
            .||.....|...|.:      .|:|:..:.::.||:|..     ..||| |:...  ||  |...
  Fly  1979 GSSNSLDSEVDAETA------ASLAASIAAMAGSGAGADLSGGFRPPAGFHDGRE--PGDHSDCE 2035

  Fly  1474 QSQSKSQSQSQSQSDLQSQEQLYAREVRELLAWCERFN 1511
            :.|.....:.|...:.....||...:..||.:...|::
  Fly  2036 REQRALDLEVQRVMESTGDAQLAKMDREELTSLLARYH 2073

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490 31/123 (25%)
Ig strand A 91..95 CDD:409490 1/8 (13%)
Ig strand A' 98..103 CDD:409490 1/4 (25%)
Ig strand B 107..115 CDD:409490 3/20 (15%)
Ig strand C 121..126 CDD:409490 1/4 (25%)
Ig strand C' 129..131 CDD:409490 0/1 (0%)
Ig strand D 139..142 CDD:409490 1/2 (50%)
Ig strand E 145..151 CDD:409490 2/14 (14%)
Ig strand F 162..170 CDD:409490 4/7 (57%)
Ig strand G 173..185 CDD:409490 4/14 (29%)
IgI_2_Robo 192..279 CDD:409389 25/89 (28%)
Ig strand A 192..195 CDD:409389 0/2 (0%)
Ig strand A' 197..201 CDD:409389 0/3 (0%)
Ig strand B 205..212 CDD:409389 1/6 (17%)
Ig strand C 220..225 CDD:409389 3/4 (75%)
Ig strand C' 227..230 CDD:409389 1/2 (50%)
Ig strand D 237..241 CDD:409389 0/4 (0%)
Ig strand E 244..250 CDD:409389 3/5 (60%)
Ig strand F 257..265 CDD:409389 4/7 (57%)
Ig strand G 268..279 CDD:409389 2/10 (20%)
Ig 286..370 CDD:472250 20/86 (23%)
Ig strand B 300..304 CDD:409353 0/3 (0%)
Ig strand C 313..317 CDD:409353 0/4 (0%)
Ig strand E 336..340 CDD:409353 1/3 (33%)
Ig strand F 350..355 CDD:409353 3/4 (75%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Ig_3 373..457 CDD:464046 19/83 (23%)
Ig 480..566 CDD:472250 23/92 (25%)
Ig strand B 496..500 CDD:409353 2/3 (67%)
Ig strand C 509..513 CDD:409353 0/3 (0%)
Ig strand E 533..537 CDD:409353 1/3 (33%)
Ig strand F 548..553 CDD:409353 2/4 (50%)
Ig strand G 561..564 CDD:409353 0/2 (0%)
COG3979 586..>800 CDD:443178 54/265 (20%)
FN3 588..681 CDD:238020 24/116 (21%)
fn3 864..952 CDD:394996 22/87 (25%)
Dscam3NP_996226.2 Ig 38..135 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 113..118 CDD:409353
Ig strand G 126..130 CDD:409353
Ig 246..337 CDD:472250
Ig strand B 264..268 CDD:409353
Ig strand C 277..281 CDD:409353
Ig strand E 303..307 CDD:409353
Ig strand F 317..322 CDD:409353
Ig strand G 330..333 CDD:409353
Ig 341..434 CDD:472250 17/94 (18%)
Ig strand B 358..362 CDD:409353
Ig strand C 371..375 CDD:409353
Ig strand E 400..404 CDD:409353 2/26 (8%)
Ig strand F 414..419 CDD:409353 1/4 (25%)
Ig strand G 427..430 CDD:409353 0/2 (0%)
IgI_4_Dscam 439..536 CDD:409548 26/102 (25%)
Ig strand A' 447..451 CDD:409548 0/3 (0%)
Ig strand B 454..463 CDD:409548 1/8 (13%)
Ig strand C 468..474 CDD:409548 2/5 (40%)
Ig strand C' 476..479 CDD:409548 0/2 (0%)
Ig strand D 487..495 CDD:409548 3/10 (30%)
Ig strand E 499..508 CDD:409548 1/8 (13%)
Ig strand F 515..523 CDD:409548 4/7 (57%)
Ig strand G 526..536 CDD:409548 3/10 (30%)
Ig 539..630 CDD:472250 26/97 (27%)
Ig strand B 556..560 CDD:409353 0/3 (0%)
Ig strand C 569..573 CDD:409353 2/3 (67%)
Ig strand E 594..598 CDD:409353 2/3 (67%)
Ig strand F 609..614 CDD:409353 2/4 (50%)
Ig strand G 623..626 CDD:409353 0/2 (0%)
Ig 633..724 CDD:472250 22/94 (23%)
Ig strand B 651..655 CDD:409353 0/3 (0%)
Ig strand C 665..669 CDD:409353 0/3 (0%)
Ig strand E 690..694 CDD:409353 1/3 (33%)
Ig strand F 704..709 CDD:409353 3/4 (75%)
Ig strand G 717..720 CDD:409353 0/2 (0%)
Ig 728..815 CDD:472250 22/96 (23%)
Ig strand B 745..749 CDD:409353 0/3 (0%)
Ig strand C 758..762 CDD:409353 2/4 (50%)
Ig strand E 780..784 CDD:409353 2/5 (40%)
Ig strand F 794..799 CDD:409353 1/4 (25%)
Ig strand G 808..811 CDD:409353 0/2 (0%)
Ig 820..913 CDD:472250 25/107 (23%)
Ig strand C 849..853 CDD:409353 0/3 (0%)
Ig strand E 879..883 CDD:409353 1/3 (33%)
Ig strand F 893..898 CDD:409353 2/4 (50%)
Ig strand G 906..909 CDD:409353 0/15 (0%)
FN3 <940..1417 CDD:442628 96/532 (18%)
Ig 1355..1430 CDD:472250 10/77 (13%)
Ig strand B 1368..1372 CDD:409353 1/3 (33%)
Ig strand C 1381..1385 CDD:409353 0/3 (0%)
Ig strand E 1403..1407 CDD:409353 0/3 (0%)
Ig strand F 1417..1422 CDD:409353 2/4 (50%)
Ig strand G 1430..1433 CDD:409353 0/2 (0%)
FN3 1441..1530 CDD:238020 17/97 (18%)
FN3 1542..1620 CDD:238020 9/81 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.