DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and zgc:77784

DIOPT Version :9

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_991212.1 Gene:zgc:77784 / 402947 ZFINID:ZDB-GENE-040426-1874 Length:140 Species:Danio rerio


Alignment Length:113 Identity:57/113 - (50%)
Similarity:75/113 - (66%) Gaps:7/113 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LKGENPRIIEHPMDTTVPKNDPFTFNCQAEGNPTPTIQWFKDGRELKTDTG---SHRIMLPAGGL 147
            |:...|||:|.|.|..|.|.:|.|.||:|||.|.||:||:|||..::||..   |||::||:|.|
Zfish    22 LEDSPPRIVEDPSDLIVSKGEPATLNCKAEGRPAPTVQWYKDGEHVETDKDDPRSHRMLLPSGSL 86

  Fly   148 FFLKVIHSRR-ESDAGTYWCEAKNEFGVARSRNATLQVA---FLRDEF 191
            |||:::|.|| :.|.|.|.|.|:|..|.|.||||:|:||   ||...|
Zfish    87 FFLRIVHGRRSKPDEGVYTCVARNYLGEAVSRNASLEVASKYFLAPGF 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317 51/98 (52%)
I-set 91..184 CDD:254352 51/96 (53%)
I-set 190..279 CDD:254352 1/2 (50%)
Ig2_Robo 193..279 CDD:143201
I-set 283..370 CDD:254352
Ig 300..370 CDD:299845
Ig 388..>457 CDD:299845
I-set 479..561 CDD:254352
Ig 496..561 CDD:143165
FN3 588..681 CDD:238020
FN3 <817..856 CDD:238020
fn3 864..952 CDD:278470
zgc:77784NP_991212.1 Ig1_Robo 26..125 CDD:143317 51/98 (52%)
I-set 27..124 CDD:254352 51/96 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6635
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000772
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101537
Panther 1 1.100 - - LDO PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X493
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.