DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and Lac

DIOPT Version :10

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:320 Identity:85/320 - (26%)
Similarity:135/320 - (42%) Gaps:51/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 ATAFLKVHVRPFLI-RGP------QNQTAVVGSSVVFQCRIGGDPLPDVLWRRT-------ASGG 323
            :|..|.:.|:..|. |.|      |.|...:|.:|.|.|.:......:||:.:|       ::|.
  Fly    12 STLLLAIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGS 76

  Fly   324 NMPLR--RVHVLEDRS-----LKLDDVTLEDMGEYTCE-ADNAVGGITATGILTVHAPPKFVIRP 380
            .:.::  |..:..|.:     |::.|:...|.|.|||: ..:.|..::|...|:|..||......
  Fly    77 TLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNS 141

  Fly   381 KNQLV-EIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVTLTPEGRSVLSIARFAR 444
            ...:| ..|.||..||.|:|:|.||:.|..|.|:  :||  .|....|..|      |.|....:
  Fly   142 TQSVVASEGSEVQMECYASGYPTPTITWRRENNA--ILP--TDSATYVGNT------LRIKSVKK 196

  Fly   445 EDSGKVVTCNALNAVGSVSSRTVVSVDTQF----ELPPPIIEQGPVNQTLPVKSIVVLPCRTLGT 505
            ||.| ...|.|.|.| |...|..::|:.:|    .:|.|.:.|.       ::..:.|.|.....
  Fly   197 EDRG-TYYCVADNGV-SKGDRRNINVEVEFAPVITVPRPRLGQA-------LQYDMDLECHIEAY 252

  Fly   506 PVPQVSWYLDGIPI-DVQEHERRNLSDAGALTISDLQ----RHEDEGLYTCVASNRNGKS 560
            |.|.:.|..|.|.: :.|.:...:.:.|...|.|.|:    .....|.|.|.|:||.|::
  Fly   253 PPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490
Ig strand A 91..95 CDD:409490
Ig strand A' 98..103 CDD:409490
Ig strand B 107..115 CDD:409490
Ig strand C 121..126 CDD:409490
Ig strand C' 129..131 CDD:409490
Ig strand D 139..142 CDD:409490
Ig strand E 145..151 CDD:409490
Ig strand F 162..170 CDD:409490
Ig strand G 173..185 CDD:409490
IgI_2_Robo 192..279 CDD:409389 2/5 (40%)
Ig strand A 192..195 CDD:409389
Ig strand A' 197..201 CDD:409389
Ig strand B 205..212 CDD:409389
Ig strand C 220..225 CDD:409389
Ig strand C' 227..230 CDD:409389
Ig strand D 237..241 CDD:409389
Ig strand E 244..250 CDD:409389
Ig strand F 257..265 CDD:409389
Ig strand G 268..279 CDD:409389 2/5 (40%)
Ig 286..370 CDD:472250 24/105 (23%)
Ig strand B 300..304 CDD:409353 2/3 (67%)
Ig strand C 313..317 CDD:409353 2/3 (67%)
Ig strand E 336..340 CDD:409353 1/8 (13%)
Ig strand F 350..355 CDD:409353 3/5 (60%)
Ig strand G 363..366 CDD:409353 1/2 (50%)
Ig_3 373..457 CDD:464046 28/84 (33%)
Ig 480..566 CDD:472250 20/86 (23%)
Ig strand B 496..500 CDD:409353 1/3 (33%)
Ig strand C 509..513 CDD:409353 0/3 (0%)
Ig strand E 533..537 CDD:409353 0/3 (0%)
Ig strand F 548..553 CDD:409353 2/4 (50%)
Ig strand G 561..564 CDD:409353 85/320 (27%)
COG3979 586..>800 CDD:443178
FN3 588..681 CDD:238020
fn3 864..952 CDD:394996
LacNP_523713.2 IG_like 36..131 CDD:214653 22/94 (23%)
Ig strand B 46..50 CDD:409381 2/3 (67%)
Ig strand C 60..63 CDD:409381 2/2 (100%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 3/4 (75%)
Ig strand G 124..127 CDD:409381 1/2 (50%)
Ig_3 134..208 CDD:464046 28/84 (33%)
Ig 227..318 CDD:472250 22/93 (24%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.