DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and DIP-eta

DIOPT Version :9

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:361 Identity:97/361 - (26%)
Similarity:135/361 - (37%) Gaps:71/361 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 RESDAGTYWCEAKNEFGVARSRNATLQVAFLRDEFRLEPANTR--VAQGEVALMECGAPRGSPEP 219
            :|||.|.|.|:...:  ..:|:...|.|....|.... |.:|.  |.:|....::|.| .|||||
  Fly   116 KESDKGWYMCQINTD--PMKSQMGYLDV
VVPPDILDY-PTSTDMVVREGSNVTLKCAA-TGSPEP 176

  Fly   220 QISWRK-NGQTLNLVGNKRIRIVDGGNLAIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVRP 283
            .|:||: :|..:.|...:.:..::|.:|.|...|:...|.|.|:..|.|....|....|.||..|
  Fly   177 TITWRRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVV
HFPP 241

  Fly   284 FLIRGPQNQT--AVVGSSVVFQCRIGGDPLPDVLWRR----------------TASGGNMPLRRV 330
            .:.  .|||.  ||.|..|...|.....|.....|.|                |..||.....|:
  Fly   242 MIT--VQNQLIGAVEGKGVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRL 304

  Fly   331 HVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATGILTVHAPPKFVIRPKNQLVEIGDEVLFEC 395
            |:        :.:|..:.|.|.|.|.|::|....| |.....||..|...:|          ||.
  Fly   305 HI--------NPLTQAEFGSYRCVAKNSLGDTDGT-IKLYRIPPNAVNYVEN----------FEA 350

  Fly   396 QANG----------HPRPTLYWSVEGNSSLLLPGYRDGRMEVTLTPE------GRSVLSIARFAR 444
            :..|          ||......|.|...:   ||.|  :.:::|..|      |.|.....|  |
  Fly   351 RHKGKKRTKSSESHHPARAQEHSGEDMEN---PGKR--KADLSLGAESIDSIYGNSAAGSRR--R 408

  Fly   445 EDSGKVVTCNALNAVGSVSSRTVVSV--DTQFELPP 478
            :|.|.|:......||....|.....|  :||..|||
  Fly   409 QDLGGVLLLLLPVAVAVAMSLATAGVMRETQMTLPP 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317 8/27 (30%)
I-set 91..184 CDD:254352 8/26 (31%)
I-set 190..279 CDD:254352 27/91 (30%)
Ig2_Robo 193..279 CDD:143201 27/88 (31%)
I-set 283..370 CDD:254352 26/104 (25%)
Ig 300..370 CDD:299845 19/85 (22%)
Ig 388..>457 CDD:299845 19/84 (23%)
I-set 479..561 CDD:254352 97/361 (27%)
Ig 496..561 CDD:143165
FN3 588..681 CDD:238020
FN3 <817..856 CDD:238020
fn3 864..952 CDD:278470
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 8/26 (31%)
IG_like 51..137 CDD:214653 7/22 (32%)
IG_like 153..237 CDD:214653 26/84 (31%)
Ig 161..224 CDD:299845 20/63 (32%)
IG_like 252..335 CDD:214653 22/91 (24%)
Ig 258..333 CDD:143165 18/83 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.