DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and fipi

DIOPT Version :9

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:447 Identity:99/447 - (22%)
Similarity:157/447 - (35%) Gaps:102/447 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 SATAFLKVHVRPFLIRGPQNQTAVVGSSVVFQCRIGGDPLPDVLWR-------RTASGGNMPLRR 329
            :|.|:...|....|.....:.......|::.||| ..||..::.|:       |...|      |
  Fly    14 TAVAWANHHESLSLSPAEHSVVRYTNESLIVQCR-SPDPKVELHWKSPKGEIIREHKG------R 71

  Fly   330 VHV----LEDRSLKLDDVTLEDMGEYTCEADNAVGGITATGI-LTVHAPPKFVIRPKNQLVEIGD 389
            :|:    .|...:....:.|.|.|.::|||  |.|.:.:... |.|:....|........|:.|:
  Fly    72 IHIEQTSTEQLKIVFAHIALADKGNWSCEA--ADGSLHSKSFDLIVYQKITFTENATVMTVKEGE 134

  Fly   390 EVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVTLTPEGRSVLSIARFAREDSGKVVTCN 454
            :....|:..|.|:|.:.|...|..  :..|..|. .:..:..:|   |.|.:..:.|:|: ..|.
  Fly   135 KATILCEVKGEPQPNVTWHFNGQP--ISAGAADD-SKFRILADG---LLINKVTQNDTGE-YACR 192

  Fly   455 A--LNAVGS-VSSRTVVSVDTQFELPPPIIEQGPVNQTLPVKSI--------VVLPCRTLGTPVP 508
            |  :|::.| :..|||:..          ||..|:....|..|:        ..|.|..|..|..
  Fly   193 AYQVNSIASDMQERTVLMK----------IEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPA 247

  Fly   509 QVSWYLDGIPIDVQEHERRN--------LSDA--GALTISDLQRHEDEGLYTCVASNRNGKSSWS 563
            ..:||        ::|.:.:        .||:  .:|||..|.....:. |.|.|  ||...:..
  Fly   248 NFTWY--------RKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDN-YRCRA--RNDLGTIE 301

  Fly   564 GYLRLD------TPTNPNIKFFRAPE----LSTYPGPPGKPQMVEKGENSVTLSWTRSNKVGGSS 618
            ...||:      :|.|..::.|.:..    ||...|||..|.    |.|...:.           
  Fly   302 RTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSPM----GVNGFRIE----------- 351

  Fly   619 LVGYVIEMFGKNETDGWVAVGTR----VQNTTFTQTGLLPGVNYFFLIRAENSHGLS 671
               |:.||..|.:...|.....:    .:..||..|.|.|...|.....:.|..|.|
  Fly   352 ---YMTEMEFKTDAGKWTNARRKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317
I-set 91..184 CDD:254352
I-set 190..279 CDD:254352 2/6 (33%)
Ig2_Robo 193..279 CDD:143201 2/6 (33%)
I-set 283..370 CDD:254352 22/98 (22%)
Ig 300..370 CDD:299845 20/81 (25%)
Ig 388..>457 CDD:299845 16/70 (23%)
I-set 479..561 CDD:254352 23/99 (23%)
Ig 496..561 CDD:143165 18/74 (24%)
FN3 588..681 CDD:238020 20/88 (23%)
FN3 <817..856 CDD:238020
fn3 864..952 CDD:278470
fipiNP_787975.1 IG_like 33..115 CDD:214653 21/90 (23%)
I-set 128..202 CDD:254352 18/80 (23%)
Ig 133..>193 CDD:299845 15/66 (23%)
IG_like 228..307 CDD:214653 19/89 (21%)
Ig 235..305 CDD:143165 18/80 (23%)
FN3 312..415 CDD:238020 25/112 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.