DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and CG33543

DIOPT Version :9

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:346 Identity:87/346 - (25%)
Similarity:132/346 - (38%) Gaps:47/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AVFPLLLLLAGLN------------GLTQVGALKGENPRIIEHPMDTTVPK-----NDPFTFNCQ 113
            |:..|||||...|            |.:..|....:.|......:..:.|.     |:.|...||
  Fly     6 ALCSLLLLLLSQNAAILGQLDSTSSGGSGTGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFCQ 70

  Fly   114 AEGNPTPTIQWFKD--GRELKTDTGSHRIMLPAGGLFFLKVIHSRRESDAGTYWCEAK-NEFGVA 175
            .......| :| :|  |:..:...|...|.....||..|...|...| |.|.:.||.. |..|  
  Fly    71 TVQKDIDT-KW-RDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALE-DRGNWTCEVNGNRNG-- 130

  Fly   176 RSRNATLQVAFL---------RDEFRLEPANTRVAQGEVALMECGAPRGSPEPQISWRKNGQTLN 231
             :||..::..||         :..|........|.:|..|::.|.. .|.|.|::||..||:.:|
  Fly   131 -NRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFV-EGMPAPEVSWLYNGEYIN 193

  Fly   232 LVGN-KRIRIVDGGNLAIQEARQSDDGRYQCVVKNVVGT---RESATAFLKVHVRP--FLIRGPQ 290
            .|.: |..|:.:|  |.|:...|:|.|.|.|....:..|   .:..|..|::..:|  |......
  Fly   194 TVNSTKHNRLSNG--LYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLP 256

  Fly   291 NQTAVVGSSVVFQCRIGGDPLPDVLWRRTASGGNMPLRRVHVLE-DRSLKLDDVTLEDMGEYTCE 354
            .|.|.||.:|...|...|:|.|...|.....|......|:.|.: ..:|:|........|:|.|:
  Fly   257 VQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNASQFGDYKCK 321

  Fly   355 ADNAVGGITATGILTVHAPPK 375
            ..|.:|.:..  ::.:...||
  Fly   322 VANPLGMLER--VIKLRPGPK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317 25/102 (25%)
I-set 91..184 CDD:254352 25/100 (25%)
I-set 190..279 CDD:254352 27/92 (29%)
Ig2_Robo 193..279 CDD:143201 26/89 (29%)
I-set 283..370 CDD:254352 22/89 (25%)
Ig 300..370 CDD:299845 16/70 (23%)
Ig 388..>457 CDD:299845
I-set 479..561 CDD:254352
Ig 496..561 CDD:143165
FN3 588..681 CDD:238020
FN3 <817..856 CDD:238020
fn3 864..952 CDD:278470
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 22/61 (36%)
IG_like 256..336 CDD:214653 20/81 (25%)
IGc2 263..327 CDD:197706 16/63 (25%)
FN3 341..445 CDD:238020 87/346 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.