DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and CG15312

DIOPT Version :10

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster


Alignment Length:578 Identity:103/578 - (17%)
Similarity:172/578 - (29%) Gaps:218/578 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   702 SGDVVELSNASVVDSTSMKLTWQIINGKYVEGFYVYARQLPNPIVNNPAPVTSNTNPLLGSTSTS 766
            :|.|:.|.|.|..|:                |.||....:|.|                .:|:||
  Fly    68 TGRVLVLRNVSTTDA----------------GIYVCFASVPRP----------------STTATS 100

  Fly   767 ASASASASALISTKPNIAAAGKRDGETNQSGGGAPTPLNTKYRMLTILNGGGASSCTITGLVQYT 831
            |:.|........|:|   ...:.||:     |.:.:|.:.:.:           ...:...|:|.
  Fly   101 ATTSPQNLQDKETRP---LEDEDDGQ-----GESVSPKDDQLK-----------EAEMEEEVEYL 146

  Fly   832 LYEFFIVPFYKSVEGKPSNSRIARTLEDVPSEAPYGMEALLLNSSAV--FLKWKAPELKDRHGVL 894
            .::              ....|.||:       |..:..|...:|.:  ||.|:..:.:.....:
  Fly   147 AHQ--------------RTKLIVRTV-------PGPVSQLYFKASTILGFLIWRFNKTQSGGYPV 190

  Fly   895 LNYHVIVRGI---------DTAHNFSRI-LTNVTIDAASPTLVLANLTEGVMYTVGVAAGNNAGV 949
            .::....|.:         ...|.:||: ..|:..:...  :.:..|.....|...:.|.|..|.
  Fly   191 RSFTAEYRNVSYKTPPANASFEHAWSRMDPINIAFNVRQ--MEVYRLAPNTTYEFRIWANNELGS 253

  Fly   950 GPY------CVPATLRLD------PITKRLDPFINQRYPINQDHVNDVLTQPWFI---ILLGAIL 999
            |..      .:|.|...|      |.....||.|                  |.:   |:||.: 
  Fly   254 GEVVTTNVTTLPETKEEDLIRLIKPDLDNFDPRI------------------WIVAVSIVLGTL- 299

  Fly  1000 AVLMLSFGAMVFVKRKHMMMKQSALNTMRGNHTSDVLKMPSLSARNGNGYWLDSSTGGMVWRPSP 1064
              ::|:.|..:.:.::.....|..|                                      ..
  Fly   300 --VILAIGLCIVLSKECYQSAQMEL--------------------------------------QD 324

  Fly  1065 GGDSLEMQKDHIADYAPVCGAPG-SPAGGGTSSGGSGGAGSGASGGDDIHGGHGSERNQQRYVGE 1128
            |.||:|:..:.|.:       || |.:.||...||.|            |||...:::    .||
  Fly   325 GWDSIELIPNIILN-------PGFSESDGGPEPGGQG------------HGGSAGDQD----AGE 366

  Fly  1129 YSNIPTDYAEVSSFGKAPSEYGRHGNASPAPYATSSILSPHQQQQQQQPRYQQRPVPGYGLQRPM 1193
                 .|..:|:........:|:|....|.|...   |.|...:.|.|                 
  Fly   367 -----DDDDDVAMPFPRTIIFGQHHRTPPPPRLH---LPPQHHRHQNQ----------------- 406

  Fly  1194 HPHYQQQQHQQQQAQQTHQQHQALQQHQQLPPSNIYQQMSTTSEIYPTN-----TGPS 1246
             .|:.|..|||.| ||.|..|  |::.......:..::...|.|.:...     |||:
  Fly   407 -SHHHQYHHQQNQ-QQHHHHH--LRRQDDDDDDDYEEEHEPTMERFKRKVSVFFTGPT 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490
Ig strand A 91..95 CDD:409490
Ig strand A' 98..103 CDD:409490
Ig strand B 107..115 CDD:409490
Ig strand C 121..126 CDD:409490
Ig strand C' 129..131 CDD:409490
Ig strand D 139..142 CDD:409490
Ig strand E 145..151 CDD:409490
Ig strand F 162..170 CDD:409490
Ig strand G 173..185 CDD:409490
IgI_2_Robo 192..279 CDD:409389
Ig strand A 192..195 CDD:409389
Ig strand A' 197..201 CDD:409389
Ig strand B 205..212 CDD:409389
Ig strand C 220..225 CDD:409389
Ig strand C' 227..230 CDD:409389
Ig strand D 237..241 CDD:409389
Ig strand E 244..250 CDD:409389
Ig strand F 257..265 CDD:409389
Ig strand G 268..279 CDD:409389
Ig 286..370 CDD:472250
Ig strand B 300..304 CDD:409353
Ig strand C 313..317 CDD:409353
Ig strand E 336..340 CDD:409353
Ig strand F 350..355 CDD:409353
Ig strand G 363..366 CDD:409353
Ig_3 373..457 CDD:464046
Ig 480..566 CDD:472250
Ig strand B 496..500 CDD:409353
Ig strand C 509..513 CDD:409353
Ig strand E 533..537 CDD:409353
Ig strand F 548..553 CDD:409353
Ig strand G 561..564 CDD:409353
COG3979 586..>800 CDD:443178 21/97 (22%)
FN3 588..681 CDD:238020
fn3 864..952 CDD:394996 17/99 (17%)
CG15312NP_001245603.1 Ig 39..90 CDD:472250 9/37 (24%)
Ig strand B 43..47 CDD:409358
Ig strand C 52..56 CDD:409358
Ig strand F 84..89 CDD:409358 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.