DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:581 Identity:142/581 - (24%)
Similarity:215/581 - (37%) Gaps:149/581 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GSHRIMLPAGGLFFLKVIHSRRESDAGTYWCEAKNEFGVAR------------------------ 176
            |.||:..|          |:||.       ...:.||.|.:                        
  Fly     5 GPHRLPRP----------HTRRR-------FRLQAEFNVRQLAITIIATAAVTMLMTATPTLAEI 52

  Fly   177 ------SRNATLQVAFLRDEFR--LEP-ANTRVAQGEVALMECGAP--RGSPEPQISW-RKNGQT 229
                  :|..|.|.|....:|.  .|| ||..|:.|..|||.|...  :|.   :::| |.:.||
  Fly    53 PSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGY---KVAWVRVDTQT 114

  Fly   230 L-----NLVG-NKRIRIVDGGN----LAIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVRPF 284
            :     |::. |.||.:....:    |.|:|..::|.|.|.|.|.  .....|...:|:|.|.|.
  Fly   115 ILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVN--TDPMRSRKGYLQVVVPPI 177

  Fly   285 LIRGPQNQTAVV--GSSVVFQCRIGGDPLPDVLWRRTASGGNMPL--RRVHVLEDRSLKLDDVTL 345
            ::.|..:...||  |.::...|:..|.|.|.|:||| ..|..|.:  ..|:|::...|.:..|:.
  Fly   178 IVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRR-EDGEEMLIGGEHVNVVDGELLHITKVSR 241

  Fly   346 EDMGEYTCEADNAV-GGITATGILTVHAPPKFVIRPKNQL--VEIGDEVLFECQANGHPRPTLYW 407
            ..|..|.|.|.|.| ..|:....|.|..||...|  .|||  ..:|.:|:.||....:|....||
  Fly   242 LHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSI--PNQLEGAYLGQDVILECHTEAYPASINYW 304

  Fly   408 SVEGNSSLLLPGYRDG-RMEVTLTPEGRS---VLSIARFAREDSGKVVTCNALNAVGSVSSRTVV 468
            :.|....::....|.| :.|.|.|..|.:   .|.|......|.| ...|.|.|::|.....  :
  Fly   305 TTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFG-TYRCVAKNSLGETDGN--I 366

  Fly   469 SVDTQFELPPP----IIEQGPVNQTLPVK--------SIVVLPCRTLGTPVPQVSWYLDGIPIDV 521
            .:|   |:|.|    |.|...:|::...|        |...||  ..|     |..:.||    .
  Fly   367 KLD---EMPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALP--DYG-----VEEWRDG----A 417

  Fly   522 QEHERRNLSD----------------AGALTISDLQ-------RHEDEGLYTCVASN---RNGKS 560
            |.:...|..|                ||:|...:|.       :.:..|::..::|:   ..|:|
  Fly   418 QGNNAGNNGDNNQTPVRNPPGAFHNSAGSLAQHNLLAKIMLGIKTQSFGIFKRLSSSLPLAAGQS 482

  Fly   561 SWSGYLRLDTPTNPNIKFFRAP---ELSTYPGPPGKPQMVEKGENSVTLSWTRSNKVGGSS 618
                :|.|.|     :....||   .:|.....|..|:.|...:.:.....|||:.|..|:
  Fly   483 ----FLWLST-----LSLVSAPSRWRMSNVENRPNSPETVVNNDTAAECWETRSHCVSESN 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317 13/78 (17%)
I-set 91..184 CDD:254352 12/77 (16%)
I-set 190..279 CDD:254352 30/104 (29%)
Ig2_Robo 193..279 CDD:143201 29/99 (29%)
I-set 283..370 CDD:254352 27/91 (30%)
Ig 300..370 CDD:299845 22/72 (31%)
Ig 388..>457 CDD:299845 20/72 (28%)
I-set 479..561 CDD:254352 22/119 (18%)
Ig 496..561 CDD:143165 16/90 (18%)
FN3 588..681 CDD:238020 8/31 (26%)
FN3 <817..856 CDD:238020
fn3 864..952 CDD:278470
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 27/96 (28%)
IG_like 82..174 CDD:214653 27/96 (28%)
IG_like 184..267 CDD:214653 25/83 (30%)
IGc2 191..255 CDD:197706 20/64 (31%)
IG_like 282..368 CDD:214653 22/88 (25%)
Ig 288..367 CDD:143165 21/81 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.