DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and Fas2

DIOPT Version :10

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:821 Identity:184/821 - (22%)
Similarity:299/821 - (36%) Gaps:177/821 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LLLLLAGLNGLTQVGALKGENPRIIEHPMDTT--VPKNDPFTFNCQAEGNPTPT----IQWFKDG 128
            |||....|..||     :.::|.:..:|....  .|...|....|:.. .|.|:    :|| ||.
  Fly    15 LLLCSCSLIELT-----RAQSPILEIYPKQEVQRKPVGKPLILTCRPT-VPEPSLVADLQW-KDN 72

  Fly   129 RE--------------LKTDTGSHRIMLPAGGLFFLKVIHSRRESDAGTYWCEAKNEFGVARSRN 179
            |.              :.|:|      ||...|..:  |.|......|.|:|.|.........:.
  Fly    73 RNNTILPKPNGRNQPPMYTET------LPGESLALM--ITSLSVEMGGKYYCTASYANTEILEKG 129

  Fly   180 ATLQVAFLRDEFRLEPANTRVAQGEVALMECGAPRGSPEPQISWRKNGQTLNLVGNKRIRIVDGG 244
            .|:: .::...:...|.|.....|:..::.|.. :..|.|.|.|.:||..:....:|  .:|...
  Fly   130 VTIK-TYVAITWTNAPENQYPTLGQDYVVMCEV-KADPNPTIDWLRNGDPIRTTNDK--YVVQTN 190

  Fly   245 NLAIQEARQSDDGRYQCVVKNVVGTRE--SATAFLKVHVRPFLIRGPQNQTAVVGSSVVFQCRIG 307
            .|.|:..::||:|.|.|... |:.|.|  ..|..::|.::|.:|..|.|..||.|......|...
  Fly   191 GLLIRNVQESDEGIYTCRAA-VIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTAR 254

  Fly   308 GDPLPDVLWRRTASGGNMPLR-RVHVLEDRSL-KLDDVTLEDMGEYTCEADNAVGGITATGILTV 370
            |.|:|::.|.|.|:..|:... |..|.....| .:..|:.:|.|.|||.|.|..|.:.....|.|
  Fly   255 GKPVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNV 319

  Fly   371 HAPPKFVIRPKNQLVEIGD-------EVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVT 428
                  ::||  |:.|:.:       |:...|:|.|.|.|.:.:...|.......|.:|....:.
  Fly   320 ------LVRP--QIYELYNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRII 376

  Fly   429 LTP-------EGRSVLSIARFAREDSGKVVTCNALN------AVGSVSSRTVVSVDTQFELPPPI 480
            |.|       |....|.|:...|.|.| :..|.|.|      ..|.::...........||||..
  Fly   377 LEPNFDEERGESTGTLRISNAERSDDG-LYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVF 440

  Fly   481 I-EQGPVNQTLPVKSIVVLPCRTLGTPVPQVSWYLDGIPI-DVQEHERRNLSDAGALTISDLQRH 543
            . ||...|          |.|..:|.|...:.|:.:|..| |:.:   .||...|....|||..|
  Fly   441 SWEQRKAN----------LSCLAMGIPNATIEWHWNGRKIKDLYD---TNLKIVGTGPRSDLIVH 492

  Fly   544 ----EDEGLYTCVASNRNGKSSWSGYLRLDTPTNPNIKFFRAPELSTYPGPPGKPQMVEKGENSV 604
                :....|.|:|:|.:|.:.          .:..:|..|.|:            .|.:.:.|.
  Fly   493 PVTRQYYSGYKCIATNIHGTAE----------HDMQLKEARVPD------------FVSEAKPSQ 535

  Fly   605 TLSWTRSNKVGGSS------LVGYVIEMFGKNETDGWVAVGTR--VQNTTFTQTGLLPGVNYFFL 661
            ..:.|.:..:.|.|      ::.|.:: :.:.....|.....|  ..::.:...||.|...|.|.
  Fly   536 LTATTMTFDIRGPSTELGLPILAYSVQ-YKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEYSFR 599

  Fly   662 IRAENSHGL-----------------SLPSPM--------SEPITVG--TRYF--------NSGL 691
            ..|.|..||                 ..|.|:        .||:.|.  :.:|        ::|.
  Fly   600 FAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNGE 664

  Fly   692 DLSEARASL-----LSGDVVELSNA----SVVDSTSMKLTWQIINGKYVEGFYVYARQLPNPI-V 746
            .:...:...     :||...||.|:    .|:::||.::| |::...|    |....:..|.| .
  Fly   665 PIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTSFEMT-QLVGNTY----YRIELKAHNAIGY 724

  Fly   747 NNPAPVTSNTNPLLGSTSTSASASASASALISTKPNIAAAG 787
            ::||.:...|...:.....:.....|::|::    .||..|
  Fly   725 SSPASIIMKTTRGIDVIQVAERQVFSSAAIV----GIAIGG 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490 24/113 (21%)
Ig strand A 91..95 CDD:409490 1/3 (33%)
Ig strand A' 98..103 CDD:409490 0/6 (0%)
Ig strand B 107..115 CDD:409490 2/7 (29%)
Ig strand C 121..126 CDD:409490 2/8 (25%)
Ig strand C' 129..131 CDD:409490 1/15 (7%)
Ig strand D 139..142 CDD:409490 0/2 (0%)
Ig strand E 145..151 CDD:409490 1/5 (20%)
Ig strand F 162..170 CDD:409490 4/7 (57%)
Ig strand G 173..185 CDD:409490 1/11 (9%)
IgI_2_Robo 192..279 CDD:409389 23/88 (26%)
Ig strand A 192..195 CDD:409389 0/2 (0%)
Ig strand A' 197..201 CDD:409389 1/3 (33%)
Ig strand B 205..212 CDD:409389 1/6 (17%)
Ig strand C 220..225 CDD:409389 2/4 (50%)
Ig strand C' 227..230 CDD:409389 1/2 (50%)
Ig strand D 237..241 CDD:409389 0/3 (0%)
Ig strand E 244..250 CDD:409389 2/5 (40%)
Ig strand F 257..265 CDD:409389 3/7 (43%)
Ig strand G 268..279 CDD:409389 3/12 (25%)
Ig 286..370 CDD:472250 27/85 (32%)
Ig strand B 300..304 CDD:409353 0/3 (0%)
Ig strand C 313..317 CDD:409353 0/3 (0%)
Ig strand E 336..340 CDD:409353 1/4 (25%)
Ig strand F 350..355 CDD:409353 3/4 (75%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Ig_3 373..457 CDD:464046 23/97 (24%)
Ig 480..566 CDD:472250 23/91 (25%)
Ig strand B 496..500 CDD:409353 1/3 (33%)
Ig strand C 509..513 CDD:409353 0/3 (0%)
Ig strand E 533..537 CDD:409353 1/3 (33%)
Ig strand F 548..553 CDD:409353 2/4 (50%)
Ig strand G 561..564 CDD:409353 0/2 (0%)
COG3979 586..>800 CDD:443178 46/255 (18%)
FN3 588..681 CDD:238020 21/125 (17%)
fn3 864..952 CDD:394996
Fas2NP_001284854.1 Ig 33..121 CDD:472250 22/97 (23%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 66..70 CDD:409353 2/4 (50%)
Ig strand E 99..103 CDD:409353 1/5 (20%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 19/72 (26%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 28/89 (31%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 1/2 (50%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 1/2 (50%)
Ig strand D 277..281 CDD:409568 1/3 (33%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 5/7 (71%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 21/94 (22%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 0/3 (0%)
Ig strand E 388..394 CDD:409353 1/5 (20%)
Ig strand F 404..409 CDD:409353 1/4 (25%)
Ig 447..515 CDD:409353 21/90 (23%)
Ig strand B 447..451 CDD:409353 2/13 (15%)
Ig strand C 460..464 CDD:409353 0/3 (0%)
Ig strand E 487..491 CDD:409353 3/3 (100%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 18/106 (17%)
FN3 640..735 CDD:238020 21/99 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.