DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo2 and sax-3

DIOPT Version :10

Sequence 1:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_001024990.1 Gene:sax-3 / 180637 WormBaseID:WBGene00004729 Length:1273 Species:Caenorhabditis elegans


Alignment Length:79 Identity:22/79 - (27%)
Similarity:32/79 - (40%) Gaps:18/79 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 LDSSATTTTDIRLSIVILMSIRMVVGMGAMFAVDVLGRRALQ-LVSICSTGLVLVAMGIVY--LA 351
            :|..|:.|....|.:|..||..:..|         |.|..|. |:::|..|:...|:..|.  |.
 Worm     1 MDEEASRTARESLELVFRMSNILDTG---------LDRHTLSVLIALCDLGVNPEALATVVKELR 56

  Fly   352 TDSI------TPDI 359
            .:||      ||.|
 Worm    57 RESIPDSVTTTPSI 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490
Ig strand A 91..95 CDD:409490
Ig strand A' 98..103 CDD:409490
Ig strand B 107..115 CDD:409490
Ig strand C 121..126 CDD:409490
Ig strand C' 129..131 CDD:409490
Ig strand D 139..142 CDD:409490
Ig strand E 145..151 CDD:409490
Ig strand F 162..170 CDD:409490
Ig strand G 173..185 CDD:409490
IgI_2_Robo 192..279 CDD:409389
Ig strand A 192..195 CDD:409389
Ig strand A' 197..201 CDD:409389
Ig strand B 205..212 CDD:409389
Ig strand C 220..225 CDD:409389
Ig strand C' 227..230 CDD:409389
Ig strand D 237..241 CDD:409389
Ig strand E 244..250 CDD:409389
Ig strand F 257..265 CDD:409389
Ig strand G 268..279 CDD:409389
Ig 286..370 CDD:472250 22/79 (28%)
Ig strand B 300..304 CDD:409353 1/3 (33%)
Ig strand C 313..317 CDD:409353 1/3 (33%)
Ig strand E 336..340 CDD:409353 1/3 (33%)
Ig strand F 350..355 CDD:409353 1/4 (25%)
Ig strand G 363..366 CDD:409353
Ig_3 373..457 CDD:464046
Ig 480..566 CDD:472250
Ig strand B 496..500 CDD:409353
Ig strand C 509..513 CDD:409353
Ig strand E 533..537 CDD:409353
Ig strand F 548..553 CDD:409353
Ig strand G 561..564 CDD:409353
COG3979 586..>800 CDD:443178
FN3 588..681 CDD:238020
fn3 864..952 CDD:394996
sax-3NP_001024990.1 Ig 31..129 CDD:472250 12/40 (30%)
Ig strand B 48..52 CDD:409353 0/3 (0%)
Ig strand C 60..64 CDD:409353 1/3 (33%)
Ig strand E 87..91 CDD:409353
Ig strand F 107..112 CDD:409353
Ig strand G 121..124 CDD:409353
IgI_2_Robo 136..223 CDD:409389
Ig strand A 136..139 CDD:409389
Ig strand A' 141..145 CDD:409389
Ig strand B 149..156 CDD:409389
Ig strand C 164..169 CDD:409389
Ig strand C' 171..174 CDD:409389
Ig strand D 180..184 CDD:409389
Ig strand E 188..194 CDD:409389
Ig strand F 201..209 CDD:409389
Ig strand G 212..223 CDD:409389
I-set 227..313 CDD:400151
Ig strand B 244..248 CDD:409353
Ig strand C 257..261 CDD:409353
Ig strand E 278..283 CDD:409353
Ig strand F 293..298 CDD:409353
Ig strand G 306..309 CDD:409353
Ig 319..411 CDD:472250
Ig strand B 334..338 CDD:409353
Ig strand C 347..351 CDD:409353
Ig strand E 376..380 CDD:409353
Ig strand F 390..395 CDD:409353
Ig strand G 403..406 CDD:409353
Ig 427..512 CDD:472250
Ig strand B 442..446 CDD:409353
FN3 <448..842 CDD:442628
Ig strand C 455..459 CDD:409353
Ig strand E 478..482 CDD:409353
Ig strand F 492..497 CDD:409353
Ig strand G 505..508 CDD:409353
FN3 531..624 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.