DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv and twsg1a

DIOPT Version :9

Sequence 1:NP_001284902.1 Gene:cv / 44510 FlyBaseID:FBgn0000394 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_571872.2 Gene:twsg1a / 84037 ZFINID:ZDB-GENE-010509-2 Length:217 Species:Danio rerio


Alignment Length:228 Identity:81/228 - (35%)
Similarity:118/228 - (51%) Gaps:43/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IVLLAIVCFYGTVESCNEVVCASIVSKCMLTQSCKCELK--NCSCCKECLKCLGKNYEECCSCVE 74
            |.:|.::.....:..||:.:|||.||||:|...|:|..:  ||||||||:.||...:||||.||.
Zfish    12 ISVLFLLSSLSLISGCNKALCASDVSKCLLQGLCQCRPQEGNCSCCKECMLCLSALWEECCDCVG 76

  Fly    75 LC-PKPNDTRNSLSKKSHVEDFDGVPELFNAVATPDEGDSFGYNWNVFTFQVDFDKYLKGPKLEK 138
            :| |:..:...:.||.:..|.:..:|.||.|:.   |||: ..|..|.:|          |..|:
Zfish    77 MCNPRSYNDSPATSKSTVEELYRPIPSLFRALT---EGDA-PINMMVVSF----------PVAEE 127

  Fly   139 DGHY-----FLRTND---KNL--------DEAIQERDNIVTVNCTVIYLDQCVSWNKCRTSCQTT 187
            ..|:     ||.|.|   :|:        |:|:          |||:|.|.|||..:|:..|::.
Zfish   128 LSHHENLVSFLETLDSQSQNISLPTSSAQDDAL----------CTVVYFDDCVSIRQCKQYCESM 182

  Fly   188 GASSTRWFHDGCCECVGSTCINYGVNESRCRKC 220
            |.|..||||:.||||:|..|::||....:|..|
Zfish   183 GGSKYRWFHNACCECIGPECLDYGSKTVKCMNC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cvNP_001284902.1 Tsg 87..221 CDD:398376 49/150 (33%)
twsg1aNP_571872.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583805
Domainoid 1 1.000 79 1.000 Domainoid score I8599
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4353
OMA 1 1.010 - - QHG47007
OrthoDB 1 1.010 - - D1254178at2759
OrthoFinder 1 1.000 - - FOG0003932
OrthoInspector 1 1.000 - - mtm6400
orthoMCL 1 0.900 - - OOG6_108753
Panther 1 1.100 - - LDO PTHR12312
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5846
SonicParanoid 1 1.000 - - X3232
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.