DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv and Twsg1

DIOPT Version :9

Sequence 1:NP_001284902.1 Gene:cv / 44510 FlyBaseID:FBgn0000394 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_075540.1 Gene:Twsg1 / 65960 MGIID:2137520 Length:222 Species:Mus musculus


Alignment Length:212 Identity:80/212 - (37%)
Similarity:117/212 - (55%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ESCNEVVCASIVSKCMLTQSCKCE--LKNCSCCKECLKCLGKNYEECCSCVELCPKPNDTRNSLS 87
            :|||:.:|||.||||::.:.|:|.  ..||.|||||:.|||..::|||.||.:|...|.:....:
Mouse    23 QSCNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPT 87

  Fly    88 KKSHVEDF-DGVPELFNAVATPDEGDSFGYNWNVFTFQVDFDKYLKGPKLEKDGHY-----FLRT 146
            .||.||:. :.:|.||.|:.   |||: ..|||:.:|          |..|:..|:     ||.|
Mouse    88 SKSTVEELHEPIPSLFRALT---EGDT-QLNWNIVSF----------PVAEELSHHENLVSFLET 138

  Fly   147 NDKNLDEAIQERDNIVTV--------NCTVIYLDQCVSWNKCRTSCQTTGASSTRWFHDGCCECV 203
            .::...:.:....|.|..        .|||:|.|.|:|.::|:.||::.|||..||||:.||||:
Mouse   139 VNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECI 203

  Fly   204 GSTCINYGVNESRCRKC 220
            |..||:||....:|..|
Mouse   204 GPECIDYGSKTVKCMNC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cvNP_001284902.1 Tsg 87..221 CDD:398376 51/148 (34%)
Twsg1NP_075540.1 Tsg 87..221 CDD:282516 51/148 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839719
Domainoid 1 1.000 88 1.000 Domainoid score I7926
eggNOG 1 0.900 - - E1_28J21
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4306
Isobase 1 0.950 - 0 Normalized mean entropy S6699
OMA 1 1.010 - - QHG47007
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003932
OrthoInspector 1 1.000 - - otm42599
orthoMCL 1 0.900 - - OOG6_108753
Panther 1 1.100 - - LDO PTHR12312
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5846
SonicParanoid 1 1.000 - - X3232
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.