DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv and TWSG1

DIOPT Version :9

Sequence 1:NP_001284902.1 Gene:cv / 44510 FlyBaseID:FBgn0000394 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_065699.1 Gene:TWSG1 / 57045 HGNCID:12429 Length:223 Species:Homo sapiens


Alignment Length:230 Identity:84/230 - (36%)
Similarity:125/230 - (54%) Gaps:30/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTVGTIVLLAIVCFYGTVESCNEVVCASIVSKCMLTQSCKCE--LKNCSCCKECLKCLGKNYEEC 69
            :.|.|:.:|..:.:.....|||:.:|||.||||::.:.|:|.  ..||||||||:.|||..::||
Human     6 VAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDEC 70

  Fly    70 CSCVELCPKPNDTRNSLSKKSHVEDF-DGVPELFNAVATPDEGDSFGYNWNVFTFQVDFDKYLKG 133
            |.||.:|...|.:....:.||.||:. :.:|.||.|:.   |||: ..|||:.:|          
Human    71 CDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALT---EGDT-QLNWNIVSF---------- 121

  Fly   134 PKLEKDGHY-----FLRTNDKNLDEAIQERDNIVTV--------NCTVIYLDQCVSWNKCRTSCQ 185
            |..|:..|:     ||.|.::...:.:....|.|..        .|||:|.|.|:|.::|:.||:
Human   122 PVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCE 186

  Fly   186 TTGASSTRWFHDGCCECVGSTCINYGVNESRCRKC 220
            :.|||..||||:.||||:|..||:||....:|..|
Human   187 SMGASKYRWFHNACCECIGPECIDYGSKTVKCMNC 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cvNP_001284902.1 Tsg 87..221 CDD:398376 51/148 (34%)
TWSG1NP_065699.1 Tsg 88..222 CDD:282516 51/148 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149655
Domainoid 1 1.000 89 1.000 Domainoid score I7865
eggNOG 1 0.900 - - E1_28J21
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4278
Isobase 1 0.950 - 0 Normalized mean entropy S6699
OMA 1 1.010 - - QHG47007
OrthoDB 1 1.010 - - D1254178at2759
OrthoFinder 1 1.000 - - FOG0003932
OrthoInspector 1 1.000 - - otm40527
orthoMCL 1 0.900 - - OOG6_108753
Panther 1 1.100 - - LDO PTHR12312
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5846
SonicParanoid 1 1.000 - - X3232
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.750

Return to query results.
Submit another query.