DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv and srw

DIOPT Version :9

Sequence 1:NP_001284902.1 Gene:cv / 44510 FlyBaseID:FBgn0000394 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_647886.2 Gene:srw / 38525 FlyBaseID:FBgn0261952 Length:136 Species:Drosophila melanogaster


Alignment Length:148 Identity:71/148 - (47%)
Similarity:88/148 - (59%) Gaps:36/148 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LSKKSHVEDFDGVPELFNAV-ATPDEGDSFGYNWNVFTFQVDFDKYLKGPKLEKDGHYFLRTNDK 149
            :.||||.|:|:|:|.||.|: ::|::|  :.|||:|.:|.                     ||.|
  Fly    24 MRKKSHTEEFEGMPALFRAMSSSPNDG--YTYNWSVVSFS---------------------TNGK 65

  Fly   150 NLDEAIQERDNIVTVNCTVIYLDQCVSWNKCRTSCQTTGASSTRWFHDGCCECVGSTCINYGVNE 214
            ...          .:||||:|||||.||||||.:|..|||:|.||||||||||||..|:||||||
  Fly    66 PGS----------GLNCTVLYLDQCTSWNKCRQTCLKTGATSYRWFHDGCCECVGELCMNYGVNE 120

  Fly   215 SRCRKCPESKGELGDELD 232
            ||||.|||.  .|.||.|
  Fly   121 SRCRLCPEP--GLEDEDD 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cvNP_001284902.1 Tsg 87..221 CDD:398376 64/134 (48%)
srwNP_647886.2 Tsg 26..127 CDD:282516 64/133 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28J21
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6699
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1254178at2759
OrthoFinder 1 1.000 - - FOG0003932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12312
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.