DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv and Twsg1

DIOPT Version :9

Sequence 1:NP_001284902.1 Gene:cv / 44510 FlyBaseID:FBgn0000394 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001102281.1 Gene:Twsg1 / 363294 RGDID:1311215 Length:222 Species:Rattus norvegicus


Alignment Length:230 Identity:85/230 - (36%)
Similarity:126/230 - (54%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTVGTIVLLAIVCFYGTVESCNEVVCASIVSKCMLTQSCKCE--LKNCSCCKECLKCLGKNYEEC 69
            ||:.:::.|  :|. ...:|||:.:|||.||||::.:.|:|.  ..||.|||||:.|||..::||
  Rat     8 LTLASLMFL--MCL-PVSQSCNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDEC 69

  Fly    70 CSCVELCPKPNDTRNSLSKKSHVEDF-DGVPELFNAVATPDEGDSFGYNWNVFTFQVDFDKYLKG 133
            |.||.:|...|.:....:.||.||:. :.:|.||.|:.   |||: ..|||:.:|          
  Rat    70 CDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALT---EGDT-QLNWNIVSF---------- 120

  Fly   134 PKLEKDGHY-----FLRTNDKNLDEAIQERDNIVTV--------NCTVIYLDQCVSWNKCRTSCQ 185
            |..|:..|:     ||.|.::...:.:....|.|..        .|||:|.|.|:|.::|:.||:
  Rat   121 PVAEELTHHENLVSFLETVNQPHHQNVSVPSNNVHAPFPSDKEHMCTVVYFDDCMSIHQCKISCE 185

  Fly   186 TTGASSTRWFHDGCCECVGSTCINYGVNESRCRKC 220
            :.|||..||||:.||||||..||:||....:|..|
  Rat   186 SMGASKYRWFHNACCECVGPECIDYGSKTVKCMNC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cvNP_001284902.1 Tsg 87..221 CDD:398376 52/148 (35%)
Twsg1NP_001102281.1 Tsg 87..221 CDD:398376 52/148 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343547
Domainoid 1 1.000 88 1.000 Domainoid score I7765
eggNOG 1 0.900 - - E1_28J21
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4214
OMA 1 1.010 - - QHG47007
OrthoDB 1 1.010 - - D1254178at2759
OrthoFinder 1 1.000 - - FOG0003932
OrthoInspector 1 1.000 - - otm44668
orthoMCL 1 0.900 - - OOG6_108753
Panther 1 1.100 - - LDO PTHR12312
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3232
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.