DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv and tsg

DIOPT Version :9

Sequence 1:NP_001284902.1 Gene:cv / 44510 FlyBaseID:FBgn0000394 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_511135.1 Gene:tsg / 32160 FlyBaseID:FBgn0003865 Length:249 Species:Drosophila melanogaster


Alignment Length:239 Identity:104/239 - (43%)
Similarity:147/239 - (61%) Gaps:29/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IVCFYGTV--------ESCNEVVCASIVSKCMLTQSCKCELKNCSCCKECLKCLGKNYEECCSCV 73
            ::.|.|..        :.||||||.|:||||::||||:|:|.:|.|||:||.|||:.|.|||.|:
  Fly     8 VILFVGIAPWSSLANDDGCNEVVCGSVVSKCLITQSCQCKLNDCHCCKDCLNCLGELYIECCGCL 72

  Fly    74 ELCPKPNDTRNSLSKKSHVEDFDGVPELFNAV-ATPDEGDSFGYNWNV--FTFQVDFDKYLKGPK 135
            ::|||..|...||:.:|.:.|.:||||||:.: |..|||      |:.  |:.:..|.:.::|..
  Fly    73 DMCPKHKDVLPSLTPRSEIGDIEGVPELFDTLTAEDDEG------WSTIRFSMRAGFKQRVQGGA 131

  Fly   136 LEKDGHYFLRTNDKNLDEAIQERDNIVTVNCTVIYLDQCVSWNKCRTSCQTTGASSTRWFHDGCC 200
            ....|:   ...:.|...|      .||: |||||::.|:..||||..|::.||||.||||||||
  Fly   132 SGDAGN---GNGNGNAGSA------GVTL-CTVIYVNSCIRANKCRQQCESMGASSYRWFHDGCC 186

  Fly   201 ECVGSTCINYGVNESRCRKCPESKGEL--GDELDDPMEEEMQDF 242
            ||||..|:|||:||||||.|||.:.:|  .|.:....|::::.|
  Fly   187 ECVGENCLNYGINESRCRGCPEDQDQLLTADTVPAEAEQDLERF 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cvNP_001284902.1 Tsg 87..221 CDD:398376 58/136 (43%)
tsgNP_511135.1 Tsg 86..207 CDD:282516 58/136 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452935
Domainoid 1 1.000 79 1.000 Domainoid score I8599
eggNOG 1 0.900 - - E1_28J21
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4353
Isobase 1 0.950 - 0 Normalized mean entropy S6699
OMA 1 1.010 - - QHG47007
OrthoDB 1 1.010 - - D1254178at2759
OrthoFinder 1 1.000 - - FOG0003932
OrthoInspector 1 1.000 - - mtm6400
orthoMCL 1 0.900 - - OOG6_108753
Panther 1 1.100 - - P PTHR12312
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5846
SonicParanoid 1 1.000 - - X3232
1413.790

Return to query results.
Submit another query.