DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment br and BTBD18

DIOPT Version :9

Sequence 1:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster
Sequence 2:NP_001138573.1 Gene:BTBD18 / 643376 HGNCID:37214 Length:712 Species:Homo sapiens


Alignment Length:568 Identity:113/568 - (19%)
Similarity:178/568 - (31%) Gaps:218/568 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELL-KSTPCKHPVILLQ--DVNFMDLHALVEF 87
            :..:.|.||.|..||.::.||..:||||||:|.|.| :..|.:...::|:  .:....|..||:|
Human    28 QQSDVFCDVLLQAEGEAVPAHCCILSACSPFFTERLERERPAQGGKVVLELGGLKISTLRKLVDF 92

  Fly    88 IYHGEVNVHQKSLQSFLKTAEVLRVSGLTQQQAEDTHSHLAQIQNLANSGGRTPLNTHTQSLPHP 152
            :|..|:.|.|:..|..|..|..||||.|...|.|                               
Human    93 LYTSEMEVSQEEAQDVLSAARQLRVSELESLQLE------------------------------- 126

  Fly   153 HHGSLHDDGGSSTLFSRQGAGSPPPTAVPSLPSHINNQLLKRMAMMHRSSAAAAAEETSHAFKRL 217
                     |...:.:.||             ..:|.:.|               :.||.|    
Human   127 ---------GGKLVKAPQG-------------RRLNRECL---------------QPTSAA---- 150

  Fly   218 RGSDNSLPLSGAVGSGSNNNSPDLPPLHARSASPQQTPADFSTIKHHNNNNTPPLKE-EKRNGPT 281
                   |:|..|.:.|::....||        ..|||.....|:         ||. .|..||.
Human   151 -------PISARVVTPSHHPHTPLP--------TNQTPCPLGAIR---------LKSLGKEEGPQ 191

  Fly   282 GNGNSGNGNGNGNGASNGNGISISDKLGSLTPSPLARAGADDVKSEPMDMVCSNNNANANDEHSN 346
            .|        |...|.|.:|..:..:.....|:|      .:..|.|      ::::....|:.|
Human   192 EN--------NRQNADNLSGTLLLKRKARACPTP------QEKNSSP------SSHSQEPRENKN 236

  Fly   347 DSTGEHDANRSSSGDGGKGSLSSGNDEEIGDGLASHHAAPQFIMSPAENKMFHAAAFNFPNIDPS 411
            |:                                   |....::||             |::.||
Human   237 DT-----------------------------------ALDPTVLSP-------------PSLYPS 253

  Fly   412 A---LLGLNTQLQQSGDLAVSPQGGSTGSLLSGVIVPGGSGGTPSNSSSNNNNNNSNNQQQKVEQ 473
            .   ||....:|.:|     .|..|...|..|.::  .||...|:..........|.|::...::
Human   254 VDKHLLPRKIRLSRS-----KPSPGICTSKPSSIL--SGSSSVPATPGRRLWRQRSVNKETPEDK 311

  Fly   474 ----QSSPHQLLQQQHHSTPHTN-----------SPQLKQEQPKSG--------------GGSCK 509
                ::||.|       |||:.:           ||:::.....|.              .|:| 
Human   312 PKPGRASPLQ-------STPNPSGLGKTGGSRKRSPEVRAPNSDSAEEGQVGRVKLRKIVNGTC- 368

  Fly   510 SSDLHIAAGSERSLSRSSQGMPDAGGHSATPSPTAAYHKRERERERER 557
               ..:...:....::.|..:||.||....||.|..:...|:|....|
Human   369 ---WEVVQETPLKNTQDSPQIPDPGGDFQEPSGTQPFSSNEQEMSPTR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brNP_001162638.2 BTB 22..118 CDD:279045 35/94 (37%)
BTB 33..118 CDD:197585 34/87 (39%)
C2H2 Zn finger 712..729 CDD:275368
C2H2 Zn finger 742..763 CDD:275368
BTBD18NP_001138573.1 BTB 24..120 CDD:306997 34/91 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..176 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..355 35/216 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..410 10/35 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 653..676
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.