DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment br and mod(mdg4)

DIOPT Version :9

Sequence 1:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster
Sequence 2:NP_788698.1 Gene:mod(mdg4) / 49228 FlyBaseID:FBgn0002781 Length:610 Species:Drosophila melanogaster


Alignment Length:668 Identity:141/668 - (21%)
Similarity:240/668 - (35%) Gaps:174/668 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDTQHFCLRWNNYQSSITSAF-ENL-RDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELLKS 63
            |.|.:.|.|.|||:.:::::.| |:| |.|  .|||:||.||:.:||||:|||.|||:||::...
  Fly     1 MADDEQFSLCWNNFNTNLSAGFHESLCRGD--LVDVSLAAEGQIVKAHRLVLSVCSPFFRKMFTQ 63

  Fly    64 TPCK-HPVILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQ-----QQAED 122
            .|.. |.::.|.:|:...|..|::|:|.|||||.|.:|.:|:.|||.|::.|||.     |..::
  Fly    64 MPSNTHAIVFLNNVSHSALKDLIQFMYCGEVNVKQDALPAFISTAESLQIKGLTDNDPAPQPPQE 128

  Fly   123 TH-----SHLAQIQNLANSGGRTPLNTHTQSLPHPHHGSLHDDGGSSTLFSRQGAGSPPPTAVPS 182
            :.     .|:.|.|..|....|.......:.........|.|:..|:|....|...:|..|.|..
  Fly   129 SSPPPAAPHVQQQQIPAQRVQRQQPRASARYKIETVDDGLGDEKQSTTQIVIQTTAAPQATIVQQ 193

  Fly   183 LPSHINNQLLKRMAMMHRSSAAAAAEETSHAFKRLRGSDNSLPLSGAVG---SGSNNNSPDLPPL 244
            .......|.::...:...::..|....|:   ||.....:..|.|.:.|   |.::.::..:.||
  Fly   194 QQPQQAAQQIQSQQLQTGTTTTATLVSTN---KRSAQRSSLTPASSSAGVKRSKTSTSANVMDPL 255

  Fly   245 HARSAS---------PQQTPADFSTI-----KHHNNNNTPPLKEEKR------NGPTGNGNSGNG 289
            .:.:.:         |||.....|.:     |.|..:.....:||..      ..|| .......
  Fly   256 DSTTETGATTTAQLVPQQITVQTSVVSAAEAKLHQQSPQQVRQEEAEYIDLPMELPT-KSEPDYS 319

  Fly   290 NGNGNGASNGNGISISDKLGSLTPSPLARAGADDVKSEPMDMVCSNNNANANDEHSNDS--TGEH 352
            ..:|:.|.:..|..:.|.                               ...|...:||  |...
  Fly   320 EDHGDAAGDAEGTYVEDD-------------------------------TYGDMRYDDSYFTENE 353

  Fly   353 DANRSSSGDGGKGSLSSGNDEEIGDGLASHHAAPQFIMSPAENKMFHAAAFNFPNIDPSALLGLN 417
            ||...::.:...|.:::...:.:....:.:::...|                   :|.|...| |
  Fly   354 DAGNQTAANTSGGGVTATTSKAVVKQQSQNYSESSF-------------------VDTSGDQG-N 398

  Fly   418 TQLQQSGDLAVSPQGGSTGSLLSGVIVPGGSGGTPSNSSSNNNNNNSNNQQQKVEQQSSPHQLLQ 482
            |:.|             ..:..|...:|....|.|               :.|||.|:...:||:
  Fly   399 TEAQ-------------AATSASATKIPPRKRGRP---------------KTKVEDQTPKPKLLE 435

  Fly   483 QQHHST--PHTNSPQLKQEQPKSG-----------------------------GGSCK------- 509
            :...:|  ...:.|.:.....|.|                             |..||       
  Fly   436 KLQAATLNEEASEPAVYASTTKGGVKLIFNGHLFKFSFRKADYSVFQCCYREHGEECKVRVVCDQ 500

  Fly   510 -------SSDLHIAAGSERSLSRSSQGMPDAGGHSATPSPTAAYHKRERERERERERERERERE- 566
                   ...:|....|::| ...||.||...|..::.||:.....:...:..|.:.:.:.:.| 
  Fly   501 KRVFPYEGEHVHFMQASDKS-CLPSQFMPGESGVISSLSPSKELLMKNTTKLEEADDKEDEDFEE 564

  Fly   567 ---RSLDHERDLERPGGT 581
               :.:| |.:|:.|..|
  Fly   565 FEIQEID-EIELDEPEKT 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brNP_001162638.2 BTB 22..118 CDD:279045 47/103 (46%)
BTB 33..118 CDD:197585 41/90 (46%)
C2H2 Zn finger 712..729 CDD:275368
C2H2 Zn finger 742..763 CDD:275368
mod(mdg4)NP_788698.1 BTB 22..118 CDD:279045 46/97 (47%)
BTB 33..118 CDD:197585 40/84 (48%)
FLYWCH 452..512 CDD:282369 5/59 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9675
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.