DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment br and ZBTB41

DIOPT Version :9

Sequence 1:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster
Sequence 2:NP_919290.2 Gene:ZBTB41 / 360023 HGNCID:24819 Length:909 Species:Homo sapiens


Alignment Length:882 Identity:155/882 - (17%)
Similarity:251/882 - (28%) Gaps:302/882 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LRDDE----AFVDVTLACEGRSIKAHRVVLSACSPYFRELLKSTPCKHPVILLQDVNFMDLHALV 85
            |.||.    :|.|:.:..||:...||:||::..|.||...|...| ...|:.|..|.......|:
Human    77 LNDDRQKQPSFCDLLIIVEGKEFSAHKVVVAVGSSYFHACLSKNP-STDVVTLDHVTHSVFQHLL 140

  Fly    86 EFIYHGEVNVHQKSLQSFLKTAEVL----RVSGLTQQQAEDTHSHLAQIQNLANSGGRTPLNTHT 146
            ||:|..|..|::..:...|:.|:.|    .|..|..:.....||.|.:     .|.....||..|
Human   141 EFLYTSEFFVYKYEIPLVLEAAKFLDIIDAVKLLNNENVAPFHSELTE-----KSSPEETLNELT 200

  Fly   147 QSLPHPHHGSLHDDGGSSTLFSRQGAGSPPPTAVPSLPSHINNQLLKRMAMMHRSSAAAAAEETS 211
            ..|.:.|....     .|..|..:          .||.:|        :|..|||....    ..
Human   201 GRLSNNHQCKF-----CSRHFCYK----------KSLENH--------LAKTHRSLLLG----KK 238

  Fly   212 HAFKRLRGSDNSLPLSGAVGSGSNNNSPDLPPLHARSASPQQTPADFSTIKHHNNNNTPPLKEEK 276
            |..|.|..|                                     ||..:...|...|...:: 
Human   239 HGLKMLERS-------------------------------------FSARRSKRNRKCPVKFDD- 265

  Fly   277 RNGPTGNGNSGNGNGNGNGASNGNGISISDKLGSLTPSPLARAGADDVKSEPMDMVCSNNNANAN 341
                |.:....:|:|:.|..........||:..|..|.....|..|:::.|            .:
Human   266 ----TSDDEQESGDGSDNLNQENFDKEKSDRNDSEDPGSEYNAEEDELEEE------------MS 314

  Fly   342 DEHSN-DSTGEHDANRSSSGDGGKGSLSSGNDEEIGDGLASHHAAPQFIMSPAENKMFHAAAFNF 405
            ||:|: :...|.|.|            .:..:.|.||.:.:.|                      
Human   315 DEYSDIEEQSEKDHN------------DAEEEPEAGDSVGNVH---------------------- 345

  Fly   406 PNIDPSALLGLNTQLQQSGDLAVSPQGGST----GSLLSGVIVPGGSG-----------GTPSNS 455
            ..:.|..:...|.::.|      .|:...|    |...|...|..|..           .|.||.
Human   346 EGLTPVVIQNSNKKILQ------CPKCDKTFDRIGKYESHTRVHTGEKPFECDICHQRYSTKSNL 404

  Fly   456 SSNNNNNNSNNQQQKVEQQSSPHQLLQQQHHSTPHTNS----------------PQLKQE----- 499
            :.:...:::..:..|.|             |..|:.|.                |:..||     
Human   405 TVHRKKHSNETEFHKKE-------------HKCPYCNKLHASKKTLAKHVKRFHPENAQEFISIK 456

  Fly   500 QPKSGGGSCKSSDLHIAAGSERSLSRSSQGMPDAGGHSATPSPTAAYHKRERERERERERERERE 564
            :.||....|   |:     .::|.:|    .|....|       ...|.:::..:.....|..:.
Human   457 KTKSESWKC---DI-----CKKSFTR----RPHLEEH-------MILHSQDKPFKCTYCEEHFKS 502

  Fly   565 RERSLDHERDLERPGGTGSPPPPPPSHHSHFGQHPLSL--------------------------- 602
            |...|.|:...                  |.|..|..:                           
Human   503 RFARLKHQEKF------------------HLGPFPCDICGRQFNDTGNLKRHIECTHGGKRKWTC 549

  Fly   603 ------------LPSHHQLHATH--HELSAAAAHHAHAHAHAAH--------AHALARAGSP-ME 644
                        |..|.::|:..  |..|.......|..::..|        .:.....|.. :.
Human   550 FICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSFRHGSSYRLHLRVHHDDKRYECDECGKTFIR 614

  Fly   645 HHHLLHHRRASLSPSGAVSSASGAGGRGGGAGGPGGPGGSLLSSVRAQDVAQANRLLLPLPLNAC 709
            |.||..|::..   ||..:......|:..|....        .:|..:.|....::...... ..
Human   615 HDHLTKHKKIH---SGEKAHQCEECGKCFGRRDH--------LTVHYKSVHLGEKVWQKYKA-TF 667

  Fly   710 HRCDVCGKLLSTKLTLKRH-KEQQHLQPLNNAVCNLCHKVFRTLNSLNNHKSIY----------- 762
            |:||||.|:...|.:|:.| :.....:|..   |.:|::.||...:|..|..|:           
Human   668 HQCDVCKKIFKGKSSLEMHFRTHSGEKPYK---CQICNQSFRIKKTLTKHLVIHSDARPFNCQHC 729

  Fly   763 ---HRRQKNHHSYFHHGAGVSQAGSPGSRLHQSLSSL 796
               .:|:.....:..|...:.....|.|...:.|.||
Human   730 NATFKRKDKLKYHIDHVHEIKSPDDPLSTSEEKLVSL 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brNP_001162638.2 BTB 22..118 CDD:279045 30/100 (30%)
BTB 33..118 CDD:197585 26/88 (30%)
C2H2 Zn finger 712..729 CDD:275368 8/17 (47%)
C2H2 Zn finger 742..763 CDD:275368 7/34 (21%)
ZBTB41NP_919290.2 BTB_POZ_ZBTB41 66..179 CDD:349535 30/102 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..344 22/120 (18%)
C2H2 Zn finger 363..383 CDD:275368 4/19 (21%)
C2H2 Zn finger 391..411 CDD:275368 3/19 (16%)
C2H2 Zn finger 424..442 CDD:275368 2/17 (12%)
C2H2 Zn finger 465..485 CDD:275368 6/38 (16%)
C2H2 Zn finger 493..510 CDD:275368 3/16 (19%)
C2H2 Zn finger 520..541 CDD:275368 0/20 (0%)
C2H2 Zn finger 549..569 CDD:275368 2/19 (11%)
C2H2 Zn finger 577..597 CDD:275368 3/19 (16%)
zf-C2H2 603..625 CDD:395048 5/21 (24%)
C2H2 Zn finger 605..625 CDD:275368 5/19 (26%)
C2H2 Zn finger 633..651 CDD:275368 3/25 (12%)
C2H2 Zn finger 670..687 CDD:275368 7/16 (44%)
C2H2 Zn finger 698..718 CDD:275368 6/19 (32%)
C2H2 Zn finger 726..743 CDD:275368 1/16 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.