DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment br and CG3726

DIOPT Version :10

Sequence 1:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster
Sequence 2:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster


Alignment Length:33 Identity:6/33 - (18%)
Similarity:20/33 - (60%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 SRIYKLFILLMSVFVTVIYAVLIRTFYLKGHHE 195
            |.|:.:||:..::::.|...::.:..::..|::
  Fly     4 SDIFPIFIVAGALWILVYCILMTQKIFMDSHYQ 36

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brNP_001162638.2 BTB_POZ_BAB-like 31..114 CDD:349624
C2H2 Zn finger 712..729 CDD:275368
C2H2 Zn finger 742..763 CDD:275368
CG3726NP_001284917.1 BTB_POZ_BAB-like 30..114 CDD:349624 1/7 (14%)
HTH_psq 587..622 CDD:283007
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.