DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment br and CG3726

DIOPT Version :9

Sequence 1:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster
Sequence 2:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster


Alignment Length:740 Identity:165/740 - (22%)
Similarity:243/740 - (32%) Gaps:292/740 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QHFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELLKSTPC-KH 68
            |.:||||..:.|::.:.|..|.|...|.||||||||:.|:||||||.|||.:|..:|.:... :.
  Fly     4 QQYCLRWKYHHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERD 68

  Fly    69 PVILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQQQAEDTHSHLAQIQNL 133
            |:|:::||.|.::..|:||:|.||:||...||.|.||||:.|::.||.:....|...        
  Fly    69 PIIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAEVTWRDDED-------- 125

  Fly   134 ANSGGRTPLNTHTQSLPHPHHGSLHDDGGSSTLFSRQGAGSPPPTAVPSLPSHINNQLLKRMAMM 198
                                                   |.|||.|.               |..
  Fly   126 ---------------------------------------GPPPPMAA---------------AEF 136

  Fly   199 H---RSSAAAAAEE--TSHAFKRLRGSDNSLPLSGAVGSGSNNNSPDLPPLHARSASPQQTPADF 258
            |   ||.|.:.|::  ..|..::.:|                   |..|||:..|::        
  Fly   137 HSPPRSLAESYAQDLILQHQQQQQQG-------------------PAAPPLNLHSSA-------- 174

  Fly   259 STIKHHNNNNTPPLKEEKRNGPTGNGNSGNGNGNGNGASNGNGISISDKLGSLTPSPLARAGADD 323
            :.::........  ::.:|..|...|..|                   ::..:||          
  Fly   175 ALLERDRERERE--RDRERLSPGMEGVLG-------------------RMPVMTP---------- 208

  Fly   324 VKSEPMDMVCSNNNANANDEHSNDSTGEHDANRSSSGDGGKGSLSSGNDEEIGDGLASHHAAPQF 388
                                    .||       :||..|.||:|.|...| |.....|...|:.
  Fly   209 ------------------------LTG-------ASGSAGVGSVSGGTSLE-GVAPVEHFLGPKR 241

  Fly   389 IMS--PAEN--------KMFHAAAFNFPNIDPSALLGLNTQLQQSGDLAVSPQGGSTGSLLSGVI 443
            ...  |.::        |:...||    |::|:....|.|....:.:..::....|..|      
  Fly   242 KRGRPPLDDAYDVFNVRKLAQYAA----NLEPAQRAYLETARHFTEEPPLAAHAASMAS------ 296

  Fly   444 VPGGSGGTPSNSSSNNNNNNSNNQQQKVEQQSSPHQLLQQQHHSTPHTNSPQLKQEQPKSGGGSC 508
                    |..:..........:|||  :||    ||||          |....||||       
  Fly   297 --------PPAACPPKQRQRLRHQQQ--QQQ----QLLQ----------SESSDQEQP------- 330

  Fly   509 KSSDLHIAAGSERS-LSRSSQGMP------DA------GGHSATPSP-TAAYHKRERERERERER 559
                   |||.:.| |..:....|      ||      ||..:.|:. |.|.....::.|:..||
  Fly   331 -------AAGQDWSNLEPNGSATPKLLSDGDANKQETEGGDESLPAVLTTASSSGTKKLEKIGER 388

  Fly   560 ERERERERSLDHERDLERPGGTGSPPPPPPSHHSHFGQHPLSLLPSHHQLHATHHELSAAAAHHA 624
               |||...|.|.|.|....|.....||.        :.|                         
  Fly   389 ---RERHGKLRHARRLYEKSGEDEVDPPK--------EEP------------------------- 417

  Fly   625 HAHAHAAHAHALARAGSPMEHHHLLHHRRASLSPS------------GAVSSASGAGGRGGGAGG 677
                     ..|.:....:|:.||:.:|..|..|:            |.|::|.|..|.|.|:|.
  Fly   418 ---------DELPQPVEEIENEHLVANRAESPRPTVVIPASFACKYEGGVTAAGGGSGSGTGSGS 473

  Fly   678 PG-----GPGGSLLSSVRAQDVAQA 697
            .|     ...|.|::...|.:||.|
  Fly   474 LGSSYLINEHGMLMAHEFAPNVASA 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brNP_001162638.2 BTB 22..118 CDD:279045 47/96 (49%)
BTB 33..118 CDD:197585 43/85 (51%)
C2H2 Zn finger 712..729 CDD:275368
C2H2 Zn finger 742..763 CDD:275368
CG3726NP_001284917.1 BTB 21..118 CDD:279045 47/96 (49%)
BTB 32..121 CDD:197585 43/88 (49%)
HTH_psq 587..622 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9675
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.