DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment br and btbd18

DIOPT Version :9

Sequence 1:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster
Sequence 2:XP_017951392.1 Gene:btbd18 / 100498010 -ID:- Length:602 Species:Xenopus tropicalis


Alignment Length:336 Identity:71/336 - (21%)
Similarity:121/336 - (36%) Gaps:85/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FVDVTL-ACEGRSIKAHRVVLSACSPYFRELLKS--------------TPCKHPVILLQDVNFMD 80
            |.|||| ..||..:..|..:|:|||||..:||.|              |.|...::.:..:....
 Frog    31 FCDVTLQGGEGEGVSVHACLLAACSPYLAKLLASVTEVSQLDTDSAIQTDCTGHILTVPGIPSCY 95

  Fly    81 LHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQQQAEDTHSHLAQIQNLANSGGRTPLNTH 145
            |..||.::|..|:.|..:::...|:.|..|::               .:::.|...|||......
 Frog    96 LLPLVHYMYTSELEVTPENVHGVLEAARRLQI---------------PELEGLRLEGGRLVRPEL 145

  Fly   146 TQSLPHPHHGSL-----HDDGGSSTLFSRQGAGSPPPTAVPSLPSHINNQLLKRMAMMHRSSAAA 205
            .:.|.....||:     .:.|....:|:::..     |:..::|           ..||......
 Frog   146 ARKLNRDCFGSVISQYATESGNGKQIFTKEEI-----TSGRNVP-----------VRMHEQGPCI 194

  Fly   206 AAEETS--HAFKRLRGSDNSLPLSGAVGSGSNNNSPDLPPLHARSASPQQT--PADFSTIKHHNN 266
            ..:.|:  |.|.    :|....|.|.:.:.|:.......||...:.:|.:.  |:...|......
 Frog   195 LEKRTNKEHTFP----ADTGSLLRGKMEASSSLQGNIENPLLEITKNPTEKSGPSTVQTCFQSRE 255

  Fly   267 NNTPPLKEEKRNGPTGNGNSGNGNGNGNGASNGNGISISDKLGSLTP----SP-------LARAG 320
            |.....::   :|.|.|.::.|           ..|.:: ||.|..|    :|       ::..|
 Frog   256 NYECAFQD---SGTTQNVSAIN-----------QDIEMT-KLSSEIPLIVLNPDQKRHILVSEHG 305

  Fly   321 ADDVKSEPMDM 331
            ||.|.|...||
 Frog   306 ADTVPSRKTDM 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brNP_001162638.2 BTB 22..118 CDD:279045 28/101 (28%)
BTB 33..118 CDD:197585 27/99 (27%)
C2H2 Zn finger 712..729 CDD:275368
C2H2 Zn finger 742..763 CDD:275368
btbd18XP_017951392.1 BTB_POZ_BTBD18 17..148 CDD:349602 32/131 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.