DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment br and Btbd18

DIOPT Version :9

Sequence 1:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster
Sequence 2:XP_002729248.1 Gene:Btbd18 / 100363270 RGDID:2323370 Length:724 Species:Rattus norvegicus


Alignment Length:683 Identity:150/683 - (21%)
Similarity:224/683 - (32%) Gaps:229/683 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AFENLRDDE---AFVDVTLACEGRSIKAHRVVLSACSPYFRELL-KSTPCKHPVILLQ--DVNFM 79
            ||..|...:   .|.|..|..||.::.||..:||||||:|.|.| :..|.:...::|:  .:...
  Rat    20 AFLQLHHQQQSGVFCDALLQAEGEAVPAHCCILSACSPFFTERLERERPVQGRKVVLELGGLKIQ 84

  Fly    80 DLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQQQAED-----------THSHLAQIQNL 133
            .|..||:|:|..|:.|.|:..|..|..|..||||.|...|.|.           .:....|..:.
  Rat    85 TLRKLVDFLYTSEMEVSQEEAQDVLSAARQLRVSELETLQLEGGKLVKAPQGRRLNRECLQPPSA 149

  Fly   134 A---------NSGGRTPL---------------------NTHTQS-LPHPHHGS----------- 156
            |         .|..||||                     ..|.:| ||:..:.|           
  Rat   150 APISARVVVPRSRPRTPLPVTQTPSPLGAVKLKSLGEEEGAHKKSNLPNADNLSDTLLLKKKARV 214

  Fly   157 -LHDDGGSSTLFSRQG----AGSPPPTAVPSLPSHINNQLLKRMAMMHRSSAAAAAEETSHAFKR 216
             |..:..||....|:|    ..:|..||:|||...::.|||.|...:.||      :.:.|.:  
  Rat   215 CLTQERSSSPSSQREGPKENKSNPGSTALPSLYPSVDEQLLPRKIRLSRS------KPSPHVY-- 271

  Fly   217 LRGSDNSLPLSGAVGSGSNNNSPDLPPLHARSAS------PQQTPADFSTIKHHNNNNTPPLKEE 275
                 .|.|.|...|..|...:|.......|:.|      .:|.|.:.||::     :||     
  Rat   272 -----TSKPSSMLSGPSSMPTAPGRRLWRQRTVSEATQGVDKQKPGEVSTLQ-----STP----- 321

  Fly   276 KRNGPTGNGNSGNGNGNGNGASNGNGISISDKLGSLTPSPLARAGADDVKSEP----------MD 330
               .|...|.:|                     |...|||.:||.|.:...|.          ::
  Rat   322 ---DPPDVGKTG---------------------GKKQPSPESRAPASNSVEEGQVGRVKLRKIVN 362

  Fly   331 MVCSNNNANANDEHSNDSTGEHDANRSSSGDGGKGS-LSSGNDEEIGDGLASHHAAP-----QFI 389
            ..|..........::.||.   ....||..|...|: |||.|::||...:...|.:|     |.|
  Rat   363 GTCWEVVQEPPIRNTQDSP---QILESSDADEPPGTLLSSVNEQEIPARIQLCHDSPENSRLQDI 424

  Fly   390 MSPAENKMFHAAA----FNFP---------NID-------PSALL--------------GLNTQL 420
            :..|.:...|...    .:.|         |||       .:.||              ...::|
  Rat   425 LLSASHSPDHPVVKSEFGSSPMLTGKEPELNIDCREPYTFDTTLLSQPCEAEQYRITSAAATSEL 489

  Fly   421 QQSGDLA-----VSPQGGSTGSLLSGVIVPGGSG-GTPSNSSSNNNNN----------------- 462
            ::..|..     |.|..||..|       ||..| .|||...|....|                 
  Rat   490 EEILDFMLCGSDVEPPVGSLES-------PGAEGCRTPSYHLSETGKNWIEGEEWCLPDMELWPR 547

  Fly   463 -NSNNQQQKVEQQSSPHQ-----LLQQQHHSTPHTNSP----------------------QLKQE 499
             .:..:::.|.:...|.:     :::.::..:....||                      ::...
  Rat   548 DLTGLEKEPVGENKEPVEPFSPLVMRSENTESIEPLSPLVMPSEVSREELSLRGSWTPDLEITSS 612

  Fly   500 QPKSGGGSCKSSDLHIAAGSERSLSRSSQGMPD 532
            ||..|.|. |...|..:..|:||.|..|...|:
  Rat   613 QPLDGQGE-KLIHLDSSDPSQRSYSDLSPPCPN 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brNP_001162638.2 BTB 22..118 CDD:279045 36/101 (36%)
BTB 33..118 CDD:197585 33/87 (38%)
C2H2 Zn finger 712..729 CDD:275368
C2H2 Zn finger 742..763 CDD:275368
Btbd18XP_002729248.1 BTB 24..123 CDD:279045 35/98 (36%)
BTB 35..123 CDD:197585 33/87 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10373
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.