DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment br and Btbd18

DIOPT Version :9

Sequence 1:NP_001162638.2 Gene:br / 44505 FlyBaseID:FBgn0283451 Length:1011 Species:Drosophila melanogaster
Sequence 2:NP_001138572.1 Gene:Btbd18 / 100270744 MGIID:3650217 Length:723 Species:Mus musculus


Alignment Length:670 Identity:142/670 - (21%)
Similarity:207/670 - (30%) Gaps:265/670 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AFENLRDDE---AFVDVTLACEGRSIKAHRVVLSACSPYFRELL-KSTPCKHPVILLQ--DVNFM 79
            ||..|...:   .|.|..|..||.::.||..:||||||:|.|.| :..|.:...::|:  .:...
Mouse    20 AFLQLHHQQQSGVFCDALLQAEGEAVPAHCCILSACSPFFTERLERERPVQGRKVVLEMGGLKIQ 84

  Fly    80 DLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQQQAEDTHSHLAQIQNLAN--------- 135
            .|..||:|:|..|:.|.|:..|..|..|..||||.|...|.|......|......|         
Mouse    85 TLRKLVDFLYTSEMEVSQEEAQDVLSAARQLRVSELETLQLEGGKLVKAPQGRRLNRECLQPPAA 149

  Fly   136 -----------SGGRTPLNTHTQSLP---------------H-----PHHGSLHD---------- 159
                       |..:|||.......|               |     |:..||.|          
Mouse   150 APISARVVGPKSRPQTPLPVTQTPSPLGAVRLKSLGEEEGAHKKTNLPNADSLSDTQLKKKARVC 214

  Fly   160 ---DGGSSTLFSRQG----AGSPPPTAVPSLPSHINNQLLKRMAMMHRSSAAAAAEETSHAFKRL 217
               :..||....|:|    ..:|.|||:|||...::.|||.|...:.||      :.:.|.:   
Mouse   215 LTQESRSSPSSQREGPKETKSNPGPTALPSLYPSVDEQLLPRKIRLSRS------KPSPHVY--- 270

  Fly   218 RGSDNSLPLSGAVGSGSNNNSPDLPPLHARSASPQ------QTPADFSTIKHHNNNNTPPLKEEK 276
                .|.|.|...|..|...:|.......|:.|.:      |.|.:...::     :||      
Mouse   271 ----TSTPSSILSGPSSMPTAPGRRLWRQRTVSKEAQGVDKQKPGEVRPLQ-----STP------ 320

  Fly   277 RNGPTGNGNSGNGNGNGNGASNGNGISISDKLGSLTPSPLARAGADDVKSEPMDMVCSNNNANAN 341
                                               .||.:.:. |::.|..|             
Mouse   321 -----------------------------------DPSDVGKP-AENKKQSP------------- 336

  Fly   342 DEHSNDSTGEHDANRSSS---GDGGKGSLSSGNDEEIGDG----------LASHHAAPQFIMSPA 393
                     |..|..|||   |..|:..|     .:|.:|          |.:...:|| |:.|:
Mouse   337 ---------ELRAPTSSSVEEGQVGRVKL-----RKIVNGTCWEVVQEPPLRNTQDSPQ-ILEPS 386

  Fly   394 ENKMFHAAAFNFPNIDPSALLGLNTQLQQSGDLAVSPQGGSTGSLLSGVIVPGGSGGTPSNSSSN 458
            :.:            :||                        |:|||.|                
Mouse   387 DVE------------EPS------------------------GTLLSSV---------------- 399

  Fly   459 NNNNNSNNQQQ---KVEQ-QSSP-----HQLLQQQHHSTPHTNSPQLKQEQPKSGGGSCKSSDLH 514
                   |:|:   :::. |.||     ..:|....||..|   |.:|.|...|...:.|.|||:
Mouse   400 -------NEQEIPARIQLCQDSPESPRLQDILLSASHSPDH---PMVKSEFGSSPMLTGKESDLN 454

  Fly   515 IAAGSERSLSRSSQGMPDAGGHSATPSPTAAYHKRERERERERERERERERERSLDH---ERDLE 576
            |......:...:..|.|                 .|.|:.|........|.|...|.   ..|:|
Mouse   455 IDCREPYTFDTTLLGQP-----------------CEAEQYRITSAAATSELEEIFDFMLCGSDVE 502

  Fly   577 RPGGT----GSPPPPPPSHH 592
            .|.|:    |:.....||:|
Mouse   503 PPVGSLESPGAEGCRTPSYH 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brNP_001162638.2 BTB 22..118 CDD:279045 36/101 (36%)
BTB 33..118 CDD:197585 33/87 (38%)
C2H2 Zn finger 712..729 CDD:275368
C2H2 Zn finger 742..763 CDD:275368
Btbd18NP_001138572.1 BTB_POZ_BTBD18 20..138 CDD:349602 40/117 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..176 4/25 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..350 45/243 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..394 7/60 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..637
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 699..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.