DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf1 and SURF1

DIOPT Version :9

Sequence 1:NP_524758.1 Gene:Surf1 / 44498 FlyBaseID:FBgn0029117 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_003163.1 Gene:SURF1 / 6834 HGNCID:11474 Length:300 Species:Homo sapiens


Alignment Length:296 Identity:129/296 - (43%)
Similarity:171/296 - (57%) Gaps:16/296 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IQTVFRNPGTANNP-----RLITRKMTQQRPPVNWT-----TSIPNQAAKDKEKIAPLGWFLLLI 70
            :|...|..|....|     |.:.|  ...||.|.|.     :|....:|...|..:.|.|.||||
Human     7 LQLGLRAAGLGRAPASAAWRSVLR--VSPRPGVAWRPSRCGSSAAEASATKAEDDSFLQWVLLLI 69

  Fly    71 PATTFGLGCWQVKRKIWKEQLIKDLNKQLSTAPVALPDDLTDLAQMEYRLVKIRGRFLHDKEMRL 135
            |.|.||||.|||:|:.||..||.:|..::...||.||.|..:|..:|||.||:||.|.|.||:.:
Human    70 PVTAFGLGTWQVQRRKWKLNLIAELESRVLAEPVPLPADPMELKNLEYRPVKVRGCFDHSKELYM 134

  Fly   136 GPRSLIRPDGVETQGGLFSQRDSGNGYLIVTPFQLADRDDIVLVNRGWVSRKQVEPETRPLGQQQ 200
            .||:::.|.....:|||.|.......| :||||...|....:|||||:|.||:|.||||..||.:
Human   135 MPRTMVDPVREAREGGLISSSTQSGAY-VVTPFHCTDLGVTILVNRGFVPRKKVNPETRQKGQIE 198

  Fly   201 AEVELTAVVRKGEARPQFTPDH--KGNVYLYRDLARMCAATGAAPVFLDAVYDPQTAAHAPIGGQ 263
            .||:|..:||..|.|..|.|::  :.|.:.||||..|...|||.|:|:||.:. .|....|||||
Human   199 GEVDLIGMVRLTETRQPFVPENNPERNHWHYRDLEAMARITGAEPIFIDANFQ-STVPGGPIGGQ 262

  Fly   264 TRVTLRNDHLSYLVTWFSLSAATSFLWYRQIVKRIP 299
            |||||||:||.|:|||:.||||||:||:::.::..|
Human   263 TRVTLRNEHLQYIVTWYGLSAATSYLWFKKFLRGTP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf1NP_524758.1 SURF1 74..289 CDD:119401 105/216 (49%)
SURF1NP_003163.1 SURF1 74..288 CDD:119401 105/215 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142160
Domainoid 1 1.000 198 1.000 Domainoid score I3087
eggNOG 1 0.900 - - E1_COG3346
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2387
Inparanoid 1 1.050 228 1.000 Inparanoid score I3477
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003659
OrthoInspector 1 1.000 - - oto90080
orthoMCL 1 0.900 - - OOG6_103106
Panther 1 1.100 - - LDO PTHR23427
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1335
SonicParanoid 1 1.000 - - X4077
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.