DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf1 and Surf1

DIOPT Version :9

Sequence 1:NP_524758.1 Gene:Surf1 / 44498 FlyBaseID:FBgn0029117 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_742065.1 Gene:Surf1 / 64463 RGDID:620527 Length:306 Species:Rattus norvegicus


Alignment Length:260 Identity:119/260 - (45%)
Similarity:163/260 - (62%) Gaps:5/260 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PVNWTTSIPNQAAKDKEKIAPLGWFLLLIPATTFGLGCWQVKRKIWKEQLIKDLNKQLSTAPVAL 106
            |....:|....||...|..:.|.||||.||||.||||.|||:|:.||.:||.:|..::...|:.|
  Rat    48 PHRCCSSTAETAAAKAEDDSFLQWFLLFIPATAFGLGTWQVQRRKWKLKLIAELESRVMAEPIPL 112

  Fly   107 PDDLTDLAQMEYRLVKIRGRFLHDKEMRLGPRSLIRPDGVETQGGLFSQRDSGNGYLIVTPFQLA 171
            |.|..:|..:|||.||:||.|.|.||:.:.||:::.|.......|..|..:|| .| :||||..:
  Rat   113 PADPMELKNLEYRPVKVRGHFDHSKELYIMPRTMVDPVREARDAGRLSSTESG-AY-VVTPFHCS 175

  Fly   172 DRDDIVLVNRGWVSRKQVEPETRPLGQQQAEVELTAVVRKGEARPQFTPDH--KGNVYLYRDLAR 234
            |....:|||||:|.||:|.||||..||...||:|..:||..|.|..|.|::  :.:::.||||..
  Rat   176 DLGVTILVNRGFVPRKKVNPETRQQGQVLGEVDLVGIVRLTENRKPFVPENNPERSLWYYRDLDA 240

  Fly   235 MCAATGAAPVFLDAVYDPQTAAHAPIGGQTRVTLRNDHLSYLVTWFSLSAATSFLWYRQIVKRIP 299
            |...||..|:|:||.:: .|....||||||||||||:|:.|::||:.|.||||:||:|:.|:|.|
  Rat   241 MAKRTGTDPIFIDADFN-STTPGGPIGGQTRVTLRNEHMQYIITWYGLCAATSYLWFRKFVRRTP 304

  Fly   300  299
              Rat   305  304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf1NP_524758.1 SURF1 74..289 CDD:119401 99/216 (46%)
Surf1NP_742065.1 SURF1 81..294 CDD:119401 98/214 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335884
Domainoid 1 1.000 192 1.000 Domainoid score I3116
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2387
Inparanoid 1 1.050 226 1.000 Inparanoid score I3396
OMA 1 1.010 - - QHG55729
OrthoDB 1 1.010 - - D491252at33208
OrthoFinder 1 1.000 - - FOG0003659
OrthoInspector 1 1.000 - - otm45501
orthoMCL 1 0.900 - - OOG6_103106
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.