DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf1 and Surf4

DIOPT Version :9

Sequence 1:NP_524758.1 Gene:Surf1 / 44498 FlyBaseID:FBgn0029117 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001029040.1 Gene:Surf4 / 619346 RGDID:1561980 Length:269 Species:Rattus norvegicus


Alignment Length:78 Identity:18/78 - (23%)
Similarity:29/78 - (37%) Gaps:17/78 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NKQLSTAPVALPDDLTDLAQMEYRLVKIRGRFLHDKEMRLGPRSLIRPDGVETQGGLFSQRDS-- 158
            |..:.||     :|..|      :.:::..::| ....||...|....||:........|||.  
  Rat     4 NDLMGTA-----EDFAD------QFLRVTKQYL-PHVARLCLISTFLEDGIRMWFQWSEQRDYID 56

  Fly   159 ---GNGYLIVTPF 168
               ..|||:.:.|
  Rat    57 TTWSCGYLLASSF 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf1NP_524758.1 SURF1 74..289 CDD:119401 18/78 (23%)
Surf4NP_001029040.1 SURF4 4..269 CDD:111019 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 192 1.000 Domainoid score I3116
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45501
orthoMCL 1 0.900 - - OOG6_103106
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.