powered by:
Protein Alignment Surf1 and Surf4
DIOPT Version :9
Sequence 1: | NP_524758.1 |
Gene: | Surf1 / 44498 |
FlyBaseID: | FBgn0029117 |
Length: | 300 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_477222.1 |
Gene: | Surf4 / 41864 |
FlyBaseID: | FBgn0019925 |
Length: | 270 |
Species: | Drosophila melanogaster |
Alignment Length: | 42 |
Identity: | 11/42 - (26%) |
Similarity: | 16/42 - (38%) |
Gaps: | 4/42 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 IPNQAAKDKEKIAPLGWFLLL----IPATTFGLGCWQVKRKI 86
:|:......:....|...:|| |....|.|..|||.:.|
Fly 146 VPSMGENKPKNFMQLAGRILLAFMFITLIRFELSVWQVIQDI 187
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Surf1 | NP_524758.1 |
SURF1 |
74..289 |
CDD:119401 |
6/13 (46%) |
Surf4 | NP_477222.1 |
SURF4 |
5..270 |
CDD:111019 |
11/42 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45439833 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR23427 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.