DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf1 and Surf4

DIOPT Version :9

Sequence 1:NP_524758.1 Gene:Surf1 / 44498 FlyBaseID:FBgn0029117 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_477222.1 Gene:Surf4 / 41864 FlyBaseID:FBgn0019925 Length:270 Species:Drosophila melanogaster


Alignment Length:42 Identity:11/42 - (26%)
Similarity:16/42 - (38%) Gaps:4/42 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IPNQAAKDKEKIAPLGWFLLL----IPATTFGLGCWQVKRKI 86
            :|:......:....|...:||    |....|.|..|||.:.|
  Fly   146 VPSMGENKPKNFMQLAGRILLAFMFITLIRFELSVWQVIQDI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf1NP_524758.1 SURF1 74..289 CDD:119401 6/13 (46%)
Surf4NP_477222.1 SURF4 5..270 CDD:111019 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23427
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.